DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and CG8944

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster


Alignment Length:285 Identity:62/285 - (21%)
Similarity:100/285 - (35%) Gaps:94/285 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1689 DHIPPASPATPASPAPPPSPAVASTVQVSELRT---------SHHCLYCEERFTNEISLKKHHQL 1744
            |.|||...|        ..|.:..|::..:|..         .::|..|..:|.|......|.||
  Fly   469 DDIPPFKCA--------HCPEIVQTLRELDLHMLTHQPSLGGGYYCNICSIQFHNAQEFDNHKQL 525

  Fly  1745 AHGALTTMPYVCTICKRGYRMRTALHRHMESHD-------------------------VEG---- 1780
            ..|.:|.:.:.|.:|...:|.:.....|:..|:                         |||    
  Fly   526 HLGGVTEIKFNCELCTASFREKANYDEHLRRHNEELFLPSLALNHSIMEGGLGDDEIGVEGEESR 590

  Fly  1781 -----------------------------------------RPYECNICRVRFPRPSQLTLHKIT 1804
                                                     :||.|::||..|..|..|..|:| 
  Fly   591 GSGSRRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRI- 654

  Fly  1805 VHL--LSKPHTCD--ECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLKELRKHRRTHSEM 1864
            ||.  ..:.:.||  :|.|.|...::|..|:|.| ....::||.|.:||:..|.|:.|::.|.::
  Fly   655 VHQDERERCYKCDYPQCNKSFVARNSLFEHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKI 719

  Fly  1865 -FYKCKFCPSSFMRFTNFRAHMKTH 1888
             .|.|:.|.|:|.:......|.:.|
  Fly   720 KRYVCQICGSAFAQAAGLYLHKRRH 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 7/20 (35%)
C2H2 Zn finger 1756..1776 CDD:275368 4/19 (21%)
C2H2 Zn finger 1785..1806 CDD:275368 8/20 (40%)
C2H2 Zn finger 1814..1834 CDD:275368 8/21 (38%)
zf-C2H2 1839..1861 CDD:278523 8/21 (38%)
C2H2 Zn finger 1841..1861 CDD:275368 8/19 (42%)
C2H2 Zn finger 1868..1888 CDD:275368 5/19 (26%)
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738 1/2 (50%)
C2H2 Zn finger 476..496 CDD:275368 4/27 (15%)
C2H2 Zn finger 506..526 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 4/19 (21%)
C2H2 Zn finger 636..656 CDD:275368 8/20 (40%)
zf-C2H2_8 639..712 CDD:292531 25/73 (34%)
C2H2 Zn finger 666..688 CDD:275368 8/21 (38%)
zf-C2H2 694..716 CDD:278523 8/21 (38%)
C2H2 Zn finger 696..716 CDD:275368 8/19 (42%)
zf-H2C2_2 708..733 CDD:290200 8/24 (33%)
C2H2 Zn finger 724..744 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.