DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and CG12219

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster


Alignment Length:447 Identity:90/447 - (20%)
Similarity:138/447 - (30%) Gaps:158/447 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1555 QQQPLMQPQSPHPSTVEMQASPTTPRKILC---------------------------CPDCE--- 1589
            |.|.|::| :..|..|    :|||..|..|                           ||.||   
  Fly   116 QPQLLLEP-AEEPKVV----TPTTANKFPCMFCEKSFKMRRYLEEHIATHTGDRPIACPYCEMAF 175

  Fly  1590 DCTSG-HSHANEQF--------EELQTLQAPPTVLTP----PSTIVSVPSPQPMVYSQHITMPSP 1641
            .|.|. ::|...:.        ||....::.....||    |:.:|.||:|.|.:.|...:..||
  Fly   176 RCRSNMYTHVKSKHTTQWLKAREERDAAKSNQNHTTPEETAPAVLVPVPAPAPALASAPASSASP 240

  Fly  1642 EQS-EPDSTTTLRQYRKRGVIVGPQGPLHLATPVASPSPSSSPSSSTVDHIP-------PASPAT 1698
            ..: .|.:|.|               |...|||..:.:.:..||..||..:|       |:....
  Fly   241 GNTVNPAATAT---------------PASSATPTTNLAAAPLPSPPTVQQLPLSVIKSQPSEAMN 290

  Fly  1699 PASPAPPPSPAVASTVQVSELRTSHHCLYCEERFTNEIS-------------------------- 1737
            ......|||.:..|..: |..|.:|.....:....:::|                          
  Fly   291 LTITKTPPSGSRGSRNR-SSRRKTHSPKKVQHTEGSDVSDEDSPQKRLKENELILANYNAVAAAV 354

  Fly  1738 -------------------------LKKHHQ------------LAHGALTTMPYVCTICKRGYRM 1765
                                     |::.||            .|....|:.....|....|..|
  Fly   355 VAAASLTGNPPGQPDSLQQRLCASLLQQQHQEQLFAVMSATAAAAAAVGTSSATTTTTTTTGTMM 419

  Fly  1766 RTALHRHMESHDVEGRPYECNICRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALKTH 1830
            ......|..| :.:.||          ..|.|..:|...|.::     |..||:..|......:.
  Fly   420 AHPYGNHPPS-ETDKRP----------AAPLQAVIHAAPVSII-----CPNCGELPGQNHRCLSK 468

  Fly  1831 IKFHGELGYQCDGCDRTFEYLKELRKHRRTHSEM-FYKCKFCPSSFMRFTNFRAHMK 1886
            .|      |.||.|.::|:..:.|.:|..||:.: .:.|.|||:.|...:|...|.|
  Fly   469 PK------YACDVCGKSFKMKRYLEEHFATHTGVKLHTCAFCPTEFRSKSNMYHHTK 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 4/83 (5%)
C2H2 Zn finger 1756..1776 CDD:275368 4/19 (21%)
C2H2 Zn finger 1785..1806 CDD:275368 3/20 (15%)
C2H2 Zn finger 1814..1834 CDD:275368 5/19 (26%)
zf-C2H2 1839..1861 CDD:278523 7/21 (33%)
C2H2 Zn finger 1841..1861 CDD:275368 6/19 (32%)
C2H2 Zn finger 1868..1888 CDD:275368 8/19 (42%)
CG12219NP_572312.1 zf-AD 2..94 CDD:285071
C2H2 Zn finger 140..160 CDD:275368 1/19 (5%)
COG4049 149..204 CDD:226535 9/54 (17%)
C2H2 Zn finger 168..186 CDD:275368 7/17 (41%)
C2H2 Zn finger 473..493 CDD:275370 6/19 (32%)
C2H2 Zn finger 501..522 CDD:275370 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439964
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.