DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and ZNF841

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_001356754.1 Gene:ZNF841 / 284371 HGNCID:27611 Length:925 Species:Homo sapiens


Alignment Length:1025 Identity:206/1025 - (20%)
Similarity:343/1025 - (33%) Gaps:245/1025 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   955 LRDLQPSQSDPPAGEQVEKIEMETQPS--TVQM---DVQSNLPVQAADTQPQNESANHSPFESPI 1014
            :::|.|.|:. ..||:.:.:.:|...|  |...   :::.||  |..|.|.::...|:.  |.|:
Human    99 IKELPPIQNS-NTGEKFQAVMLEGHESYDTENFYFREIRKNL--QEVDFQWKDGEINYK--EGPM 158

  Fly  1015 S-SPQVQSQIELQMEPQIETQ-MQPQIETRMQHDVLSVQSPQNHQPQVQSHDQSQMQHQIPPQIE 1077
            : ...:..|.....:..:|.: |:.|:..|.|..:..:|                 :.|...:|.
Human   159 THKNNLTGQRVRHSQGDVENKHMENQLILRFQSGLGELQ-----------------KFQTAEKIY 206

  Fly  1078 PQIEVQNQEQNTLQLVPQAQHQVVPHVQLQSQLVPHVQTQGTTTTVTYEQIYQQHIVQQTVQQSS 1142
            ...:::....|.....|           || ::.|.|||       ...:.|....:|.::....
Human   207 GCNQIERTVNNCFLASP-----------LQ-RIFPGVQT-------NISRKYGNDFLQLSLPTQD 252

  Fly  1143 NKMQVISLPSAGSETTRQWQTQQSQQQQQVQWSSVGGLEAIKSAPVESVAPTTTTYYISASDLYP 1207
            .|..:...|..|:|..:.::...|....|:..::.......:|..........|.:.|..:...|
Human   253 EKTHIREKPYIGNECGKAFRVSSSLINHQMIHTTEKPYRCNESGKAFHRGSLLTVHQIVHTRGKP 317

  Fly  1208 QQTETYTMLQPASNESYVIEQVNHQQQH-------CQQ-QIQMSQQQHQRQHQQQQAQQQQQPIM 1264
            .|.:....:...::     :.|||::.|       |.: ....|:..|...||:           
Human   318 YQCDVCGRIFRQNS-----DLVNHRRSHTGDKPYICNECGKSFSKSSHLAVHQR----------- 366

  Fly  1265 ILIQQPEIQQPVASASNPQQAPL--HIYNAATSNDVHQMQHTQRQQIRQQYQHQQYQRLQQPQQT 1327
                       :.:...|.:...  ..::.::|...||..||..:..:.....:.::|       
Human   367 -----------IHTGEKPYKCNRCGKCFSQSSSLATHQTVHTGDKPYKCNECGKTFKR------- 413

  Fly  1328 RVVQSHPVLGMPGATSISTKVTPIPVTAARGRPLTLKCRFCHNGPRFSSSLEYSRHIIDLHPAVA 1392
                             ::.:|...:..|..:|.|  |..|  |..|..:.:..||.| :|....
Human   414 -----------------NSSLTAHHIIHAGKKPYT--CDVC--GKVFYQNSQLVRHQI-IHTGET 456

  Fly  1393 PFNCPHCPMAFAGRTKRSQHILSHHVVQQYQCGQCSHVFPAQKALDVHIQRFHMTLKTDPSGAVK 1457
            |:.|..|...|..|::.:.|...|...:.|:|.:|..||.....|.|| ||.|            
Human   457 PYKCNECGKVFFQRSRLAGHRRIHTGEKPYKCNECGKVFSQHSHLAVH-QRVH------------ 508

  Fly  1458 VEDVQLQITSERRPRGRPYKPRLQLQQHQLQPQQKLQVQQHQQQQKALQQLPQAQHHQQQQQPQL 1522
                    |.|     :|||                           ..:..:|           
Human   509 --------TGE-----KPYK---------------------------CNECGKA----------- 522

  Fly  1523 QQEVLQQVQQLQVQVQPQQHQQHQQVLQVQQPQQQPLMQPQSPHPSTVEMQASPTTPRKILCCPD 1587
                ......|.|         ||::...::|.:..:......:...:.:.....|..|.|.|..
Human   523 ----FNWGSLLTV---------HQRIHTGEKPYKCNVCGKVFNYGGYLSVHMRCHTGEKPLHCNK 574

  Fly  1588 C------EDCTSGHS--HANEQFEELQTLQAPPTVLTPPSTIVSVPSPQPMVYSQHITMPSPEQS 1644
            |      ..|.:.|.  |..|:..:......           |.:.|....::.:..|...|.|.
Human   575 CGMVFTYYSCLARHQRMHTGEKPYKCNVCGK-----------VFIDSGNLSIHRRSHTGEKPFQC 628

  Fly  1645 EP-----DSTTTLRQYRKRGVIVGPQGPLHLATPVASPSPSSSPSSSTVDHIPPASPATPASPAP 1704
            ..     ...:.|.::||   |...:.|........:.:..||.:...|.|       |..:|..
Human   629 NECGKVFSYYSCLARHRK---IHTGEKPYKCNDCGKAYTQRSSLTKHLVIH-------TGENPYH 683

  Fly  1705 PPSPAVASTVQVSEL---------RTSHHCLYCEERFTNEISLKKHHQLAHGALTTMPYVCTICK 1760
            ......| .:|.|:|         ...|.|..|...|:::.|| .:||..|..  .|||.|..|.
Human   684 CNEFGEA-FIQSSKLARYHRNPTGEKPHKCSECGRTFSHKTSL-VYHQRRHTG--EMPYKCIECG 744

  Fly  1761 RGYRMRTALHRHMESHDVEGRPYECNICRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTES 1825
            :.:...|.|.||...|..| :||:||.|...|...|.|..| .::|...||:.|:||||.|...|
Human   745 KVFNSTTTLARHRRIHTGE-KPYKCNECGKVFRYRSGLARH-WSIHTGEKPYKCNECGKAFRVRS 807

  Fly  1826 ALKTHIKFH-GELGYQCDGCDRTFEYLKELRKHRRTHS-EMFYKCKFCPSSFMRFTNFRAHMKTH 1888
            .|..|...| ||..|:|:.|.:.|.....|..|:|.|: |..|||..|..:|.|.:....|.:.|
Human   808 ILLNHQMMHTGEKPYKCNECGKAFIERSNLVYHQRNHTGEKPYKCMECGKAFGRRSCLTKHQRIH 872

  Fly  1889 LPLGVFR-NEDAASK-SPSNNNSHASSDKLENPATPIE-ETPLTPMSSGG 1935
            .....:: ||...|. |.|....|......||..|.:. |.||..:.:.|
Human   873 SSEKPYKCNECGKSYISRSGLTKHQIKHAGENLTTKLNVERPLDVVLTSG 922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368 7/22 (32%)
C2H2 Zn finger 1396..1416 CDD:275368 5/19 (26%)
C2H2 Zn finger 1424..1445 CDD:275368 9/20 (45%)
C2H2 Zn finger 1725..1746 CDD:275368 7/20 (35%)
C2H2 Zn finger 1756..1776 CDD:275368 6/19 (32%)
C2H2 Zn finger 1785..1806 CDD:275368 7/20 (35%)
C2H2 Zn finger 1814..1834 CDD:275368 9/19 (47%)
zf-C2H2 1839..1861 CDD:278523 7/21 (33%)
C2H2 Zn finger 1841..1861 CDD:275368 6/19 (32%)
C2H2 Zn finger 1868..1888 CDD:275368 5/19 (26%)
ZNF841NP_001356754.1 KRAB 8..69 CDD:214630
COG5048 260..636 CDD:227381 81/519 (16%)
C2H2 Zn finger 265..284 CDD:275368 3/18 (17%)
C2H2 Zn finger 292..312 CDD:275368 3/19 (16%)
C2H2 Zn finger 320..340 CDD:275368 3/24 (13%)
C2H2 Zn finger 348..368 CDD:275368 5/41 (12%)
C2H2 Zn finger 376..396 CDD:275368 3/19 (16%)
C2H2 Zn finger 404..424 CDD:275368 2/43 (5%)
C2H2 Zn finger 432..452 CDD:275368 7/22 (32%)
C2H2 Zn finger 460..480 CDD:275368 5/19 (26%)
COG5048 484..886 CDD:227381 114/505 (23%)
C2H2 Zn finger 488..508 CDD:275368 9/20 (45%)
C2H2 Zn finger 516..536 CDD:275368 5/43 (12%)
C2H2 Zn finger 544..564 CDD:275368 0/19 (0%)
C2H2 Zn finger 572..592 CDD:275368 4/19 (21%)
C2H2 Zn finger 600..620 CDD:275368 2/30 (7%)
C2H2 Zn finger 628..648 CDD:275368 3/22 (14%)
C2H2 Zn finger 656..676 CDD:275368 3/19 (16%)
C2H2 Zn finger 712..732 CDD:275368 7/20 (35%)
C2H2 Zn finger 740..760 CDD:275368 6/19 (32%)
C2H2 Zn finger 768..788 CDD:275368 7/20 (35%)
C2H2 Zn finger 796..816 CDD:275368 9/19 (47%)
C2H2 Zn finger 824..844 CDD:275368 6/19 (32%)
C2H2 Zn finger 852..872 CDD:275368 5/19 (26%)
C2H2 Zn finger 880..900 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.