DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and Zfp764

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_666315.3 Gene:Zfp764 / 233893 MGIID:2443580 Length:431 Species:Mus musculus


Alignment Length:518 Identity:107/518 - (20%)
Similarity:165/518 - (31%) Gaps:158/518 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1455 AVKVEDVQLQITSER----RPRGRPYKPRLQLQQHQL---------QPQQKLQVQQHQQQQKALQ 1506
            ||...||.:..:.|.    ||..|.....:..:.:.|         :|.....|::..:......
Mouse    21 AVSFADVAVYFSPEEWRCLRPAQRALYREVMRETYGLLASLGLGGAKPALICWVEEESEVWGPCA 85

  Fly  1507 QLPQ-----------AQHHQQQQQPQLQQEVLQQVQQLQVQVQPQQHQQHQQVLQVQQPQ--QQP 1558
            |.|:           .:|.:::::|:.:.|.:|:.      ..|:..|:..|:.......  |..
Mouse    86 QDPEVAMCRTEVHSDCRHEKERKRPREETEAMQKT------FSPEPGQKEPQLSFAGSASGIQAT 144

  Fly  1559 LMQPQSPH------------PSTVEMQASPTTPRKILCCPDCEDCTSGHS--------HANEQFE 1603
            :::....|            |:.|| .....|..|...||||..|....|        |..|:  
Mouse   145 VLRADKRHGCHLCGKSFAQRPTLVE-HLYTHTGEKPFQCPDCNKCFGRASSLTMHRAIHRGER-- 206

  Fly  1604 ELQTLQAPPTVLTPPSTIVSVPSPQPMVYSQHITMPSPEQSEPDSTTTLRQYRKRGVIVGPQGPL 1668
                                                 |.|. ||..   :.:.:|..:|.     
Mouse   207 -------------------------------------PHQC-PDCG---KSFTQRSTLVA----- 225

  Fly  1669 HLATPVASPSPSSSPSSSTVDHIPPASPATPASPAPPPSPAVASTVQVSELRTSHHCLYCEERFT 1733
            |:.|.... .|...|.                                           |.:.|:
Mouse   226 HMYTHTGE-KPFCCPD-------------------------------------------CNKSFS 246

  Fly  1734 NEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYECNICRVRFPRPSQL 1798
            ...||..|..:..|   ..|:.|..|.|.:..|:.|..|:..|..| :||.|..|...|.:.|..
Mouse   247 RSSSLSSHRAIHRG---ERPHCCPDCGRAFTRRSGLIAHLRIHTGE-KPYCCADCGRCFSQRSAF 307

  Fly  1799 TLHKITVHLLSKPHTCDECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLKELRKHRRTHS 1862
            ..|:..||....|.||..||:.|.....|:.|::.| ||..|.|..|.|.|....|:..|||||:
Mouse   308 REHQRVVHSGVTPFTCTHCGRAFADSKYLRRHMRIHTGEKPYSCPDCGRCFRQSSEIPAHRRTHT 372

  Fly  1863 -EMFYKCKFCPSSFMRFTNFRAHMKTHLPLGVFRNEDAASKSPSNNNSHASSD-KLENPATPI 1923
             |..|.|..|...|...:...:|...|.| |...::|..::..|     .|.| :.|:|..|:
Mouse   373 GERPYPCPQCGRQFRTKSAMTSHQWVHRP-GAKGHKDKKARQLS-----ISLDPRQEDPDPPV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 5/20 (25%)
C2H2 Zn finger 1756..1776 CDD:275368 6/19 (32%)
C2H2 Zn finger 1785..1806 CDD:275368 5/20 (25%)
C2H2 Zn finger 1814..1834 CDD:275368 6/19 (32%)
zf-C2H2 1839..1861 CDD:278523 9/21 (43%)
C2H2 Zn finger 1841..1861 CDD:275368 8/19 (42%)
C2H2 Zn finger 1868..1888 CDD:275368 4/19 (21%)
Zfp764NP_666315.3 KRAB 22..81 CDD:214630 10/58 (17%)
KRAB 22..55 CDD:279668 7/32 (22%)
C2H2 Zn finger 154..174 CDD:275368 3/20 (15%)
zf-H2C2_2 167..191 CDD:290200 9/24 (38%)
COG5048 178..>243 CDD:227381 20/156 (13%)
C2H2 Zn finger 182..202 CDD:275368 6/19 (32%)
zf-H2C2_2 194..219 CDD:290200 6/67 (9%)
C2H2 Zn finger 210..230 CDD:275368 5/28 (18%)
zf-H2C2_2 223..243 CDD:290200 6/68 (9%)
COG5048 262..>317 CDD:227381 18/55 (33%)
C2H2 Zn finger 266..286 CDD:275368 6/19 (32%)
zf-H2C2_2 282..303 CDD:290200 8/21 (38%)
zf-C2H2 321..343 CDD:278523 7/21 (33%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
zf-H2C2_2 335..360 CDD:290200 10/24 (42%)
C2H2 Zn finger 351..371 CDD:275368 8/19 (42%)
zf-H2C2_2 367..388 CDD:290200 10/20 (50%)
C2H2 Zn finger 379..399 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.