DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and Zfp92

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_033592.2 Gene:Zfp92 / 22754 MGIID:108094 Length:488 Species:Mus musculus


Alignment Length:168 Identity:60/168 - (35%)
Similarity:80/168 - (47%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1723 HHCLYCEERFTNEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYECNI 1787
            :.|..|.:.||...:|.| ||:.|.  :.||:||.:|.:.:|...||..|...|..| ||:||..
Mouse   197 YECGECGKTFTRSSNLVK-HQVIHS--SEMPFVCRMCGKVFRRSFALLEHTRIHSGE-RPFECTE 257

  Fly  1788 CRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYL 1851
            |...|.|.|.|..|: .:|...||:.|.||||.|...|.|..|...| |:..:.|....:.|..|
Mouse   258 CGKAFSRSSNLIEHQ-RIHSGQKPYICKECGKAFKGVSQLIHHQLIHRGDKPFTCHEYGKAFRGL 321

  Fly  1852 KELRKHRRTH-SEMFYKCKFCPSSFMRFTNFRAHMKTH 1888
            ..|.:|:|.| .|..|:|..|..:|.|..|...|...|
Mouse   322 SGLSQHQRVHRGEKPYECSECGRAFGRRANLFKHQVVH 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 8/20 (40%)
C2H2 Zn finger 1756..1776 CDD:275368 6/19 (32%)
C2H2 Zn finger 1785..1806 CDD:275368 7/20 (35%)
C2H2 Zn finger 1814..1834 CDD:275368 9/19 (47%)
zf-C2H2 1839..1861 CDD:278523 6/21 (29%)
C2H2 Zn finger 1841..1861 CDD:275368 6/19 (32%)
C2H2 Zn finger 1868..1888 CDD:275368 6/19 (32%)
Zfp92NP_033592.2 KRAB 14..74 CDD:214630
COG5048 <134..299 CDD:227381 41/106 (39%)
C2H2 Zn finger 143..163 CDD:275368
C2H2 Zn finger 171..191 CDD:275368
C2H2 Zn finger 199..219 CDD:275368 8/20 (40%)
C2H2 Zn finger 227..247 CDD:275368 6/19 (32%)
C2H2 Zn finger 255..275 CDD:275368 7/20 (35%)
C2H2 Zn finger 283..303 CDD:275368 9/19 (47%)
C2H2 Zn finger 311..331 CDD:275368 6/19 (32%)
zf-H2C2_2 324..348 CDD:372612 9/23 (39%)
C2H2 Zn finger 339..359 CDD:275368 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..408
C2H2 Zn finger 412..432 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 435..488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.