DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and syd-9

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_001362162.1 Gene:syd-9 / 180985 WormBaseID:WBGene00044068 Length:554 Species:Caenorhabditis elegans


Alignment Length:506 Identity:100/506 - (19%)
Similarity:164/506 - (32%) Gaps:169/506 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1319 QRLQQPQ------QTRVVQSH-PVLGMPGATSISTKVTPIPVTAARGRPLTLKCRFCHNGPRFSS 1376
            :.|..||      .|:::|.| .:.....:..:|.|.|..||    |......|..|....||.|
 Worm    18 ESLTCPQCPKSFSSTKLLQQHQQMFHTDKSVLLSLKSTDAPV----GMDRAFICETCGKAFRFRS 78

  Fly  1377 SLEYSRHIIDLHPAVAPFNCPHCPMAFAGRTKR-----SQHILSHHVVQQYQC------------ 1424
            :|...|.:   |.|:.|:.|..|     |::.|     ::|||.||..:|.:.            
 Worm    79 NLAEHRSV---HTALKPYVCKFC-----GKSSRLKGNLTKHILKHHKKEQNEAIAKDDIIVKKAP 135

  Fly  1425 -------GQCSH------------VFPAQKAL------------------------DVHIQRFHM 1446
                   |..::            |.....||                        ::....:::
 Worm   136 KIVTKDNGPTTNGSTPTTSTATPSVITVSSALASSNGHNNNNNNHAVNNNLRTIKMELEDPDYNL 200

  Fly  1447 TLKTDPSGAVKVEDVQLQITSERRPRGRPYKPRLQLQQHQLQPQQKLQVQQHQQQQKALQQLPQA 1511
            ..|:.|:..|.    ::..|....||.||....::.....:.|  .:.|.:..::...|      
 Worm   201 IAKSAPTPVVS----KIVATHTVTPRSRPTPKDIKEILETIAP--SVGVSETPEEMCLL------ 253

  Fly  1512 QHHQQQQQPQLQQEVLQQVQQLQVQVQPQQHQQHQQVLQVQQPQQQPLMQPQSPHPSTVEMQASP 1576
               .:....:..:.||..:...........|||.|||::..:.                |:..||
 Worm   254 ---PKDASSESDRSVLISLGFDFGSTLSLNHQQLQQVVRELKG----------------ELSISP 299

  Fly  1577 TTPRKILCCPDCEDCTSGHSHANEQFEELQTLQAPPTVLTPPSTIVSVPSPQPMVYSQHITMPSP 1641
            .|.:            |.||   :.||:   ...||..:...||:....:...|:.:  .|..|.
 Worm   300 DTVQ------------SDHS---DDFEQ---DSPPPMAIANISTVGGEATLAAMIVA--ATNASG 344

  Fly  1642 EQSE--PDSTTTLRQYRKRGVIVGPQGPLHLATPVASPSPSSS---------------------- 1682
            ::.:  ||||.|     ::|  ..||..|   :|.:.||.||.                      
 Worm   345 QRGDGTPDSTDT-----QKG--CSPQREL---SPESDPSTSSGDSCPSPPKMLHCKECGTLVRKS 399

  Fly  1683 ---PSSSTVDH-IPPASPATPASPAPPPSPAVASTVQVSELRTSHHCLYCE 1729
               |...|:.| .||...|.|....|.|...|.::...:|||...:.: ||
 Worm   400 SHLPIHMTMSHGYPPPLVAAPVEEKPAPEQPVNASSLHNELRVISNAI-CE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368 7/22 (32%)
C2H2 Zn finger 1396..1416 CDD:275368 7/24 (29%)
C2H2 Zn finger 1424..1445 CDD:275368 4/75 (5%)
C2H2 Zn finger 1725..1746 CDD:275368 2/5 (40%)
C2H2 Zn finger 1756..1776 CDD:275368
C2H2 Zn finger 1785..1806 CDD:275368
C2H2 Zn finger 1814..1834 CDD:275368
zf-C2H2 1839..1861 CDD:278523
C2H2 Zn finger 1841..1861 CDD:275368
C2H2 Zn finger 1868..1888 CDD:275368
syd-9NP_001362162.1 C2H2 Zn finger 22..43 CDD:275368 5/20 (25%)
zf-C2H2 65..87 CDD:333835 7/24 (29%)
C2H2 Zn finger 67..87 CDD:275368 7/22 (32%)
zf-C2H2 93..115 CDD:333835 7/26 (27%)
C2H2 Zn finger 95..115 CDD:275368 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.