DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and ZNF384

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_001372672.1 Gene:ZNF384 / 171017 HGNCID:11955 Length:608 Species:Homo sapiens


Alignment Length:550 Identity:112/550 - (20%)
Similarity:168/550 - (30%) Gaps:213/550 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1612 PTVLTPPSTIVSVPSPQPM---------------VYSQHIT-MPSPEQSEPDSTTTLRQ-YRKRG 1659
            ||:||.|:: ||:||...|               ..:|:|| :|.|......:..:..| :|:.|
Human    50 PTLLTVPAS-VSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTAGVSCSQRWRREG 113

  Fly  1660 --------VIVGPQGPLHLATPVASPSPSSSPSSSTVDHIPPASPATPASP-------------- 1702
                    ||..|.|.|......|...|.|:|  ..|..:||.|.|....|              
Human   114 SQSRGPGLVITSPSGSLVTTASSAQTFPISAP--MIVSALPPGSQALQVVPDLSKKVASTLTEEG 176

  Fly  1703 ----------APPP-----------------------SP-------------------------- 1708
                      ||.|                       ||                          
Human   177 GGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRSEGNCGTGNGQS 241

  Fly  1709 ------AVASTVQV----------------SELR---------TSHHCLYCEERFTNEISLKKHH 1742
                  ...||..:                ||::         ..|.|.:|.:.|.|...|.:|.
Human   242 LGLMDSVPGSTTNLLCDPGCRMCSLTFYSKSEMQIHSKSHTETKPHKCPHCSKTFANSSYLAQHI 306

  Fly  1743 QLAHGALTTMPYVCTICKRGYRMRTALHR----HMESHDVEGRPYECNICRVRFPRPSQLTLHKI 1803
            ::..||   .||.|..|::.:|..:.|.:    |.:.|....:|::|..|...|...|.|..| :
Human   307 RIHSGA---KPYSCNFCEKSFRQLSHLQQHTRIHSKMHTETIKPHKCPHCSKTFANTSYLAQH-L 367

  Fly  1804 TVHLLSKPHTCDECGKQFGTESALKTHIKFH-GELGYQC--DGCDRTFEYLKELRKHRRTHSE-- 1863
            .:|..:||:.|..|.|.|...|.|:.|.:.| |:..|:|  .||::.|..|..|:.|||.|::  
Human   368 RIHSGAKPYNCSYCQKAFRQLSHLQQHTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKDK 432

  Fly  1864 -----------------------------MFYKCKFCPSSFMRFTNFRAHMKTHLPLGVFRNEDA 1899
                                         ..|.|..|..::...|....||:.|.|..:.:...|
Human   433 PFKCHNCHRAYTDAASLEVHLSTHTVKHAKVYTCTICSRAYTSETYLMKHMRKHNPPDLQQQVQA 497

  Fly  1900 ASKSPSNNNSHASS-------------------------------DKLENPATPIEETPLTPMSS 1933
            |:.:.:...:.|.:                               .:.:.|....:.....|...
Human   498 AAAAAAVAQAQAQAQAQAQAQAQAQAQAQASQASQQQQQQQQQQQQQQQQPPPHFQSPGAAPQGG 562

  Fly  1934 GGHLYHSPDEYPNSVESCAGNSVALESYAT 1963
            ||     .|..||....|   |..|..|.|
Human   563 GG-----GDSNPNPPPQC---SFDLTPYKT 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 6/20 (30%)
C2H2 Zn finger 1756..1776 CDD:275368 5/23 (22%)
C2H2 Zn finger 1785..1806 CDD:275368 6/20 (30%)
C2H2 Zn finger 1814..1834 CDD:275368 7/19 (37%)
zf-C2H2 1839..1861 CDD:278523 10/23 (43%)
C2H2 Zn finger 1841..1861 CDD:275368 9/21 (43%)
C2H2 Zn finger 1868..1888 CDD:275368 5/19 (26%)
ZNF384NP_001372672.1 C2H2 Zn finger 261..281 CDD:275368 2/19 (11%)
COG5048 <284..486 CDD:227381 53/205 (26%)
C2H2 Zn finger 289..309 CDD:275368 6/19 (32%)
C2H2 Zn finger 317..337 CDD:275368 4/19 (21%)
C2H2 Zn finger 350..370 CDD:275368 6/20 (30%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..428 CDD:275368 9/21 (43%)
C2H2 Zn finger 436..456 CDD:275368 0/19 (0%)
C2H2 Zn finger 466..486 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.