DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and ZNF688

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:XP_024305933.1 Gene:ZNF688 / 146542 HGNCID:30489 Length:384 Species:Homo sapiens


Alignment Length:444 Identity:92/444 - (20%)
Similarity:149/444 - (33%) Gaps:122/444 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1430 VFPAQKALDVHIQRFHMTLKTDPSGAVKVEDVQLQITSERRPRGRPYKPRLQLQQHQLQPQQKLQ 1494
            |||  :.|....|       ..|||.. |.|.:......||.||....|..         ||:||
Human     8 VFP--RGLGTKFQ-------LPPSGGT-VRDRRGHNPEHRRCRGLRCAPVC---------QQRLQ 53

  Fly  1495 VQQHQQQQKALQ-QLPQAQHHQQQQ-----------QPQL--QQEVLQQVQQL------------ 1533
            .:........:. |.|::....::|           .|::  .|.:|.::.:|            
Human    54 DRGVPSNAPPVPGQSPRSFFRDRRQSSAVAYCGYRGNPRIPSSQSLLLRLPRLRSDATAGRGRPS 118

  Fly  1534 --QVQVQPQQHQQHQQVLQVQQPQQQPLMQPQSPHPSTVEMQASPTTPRKILCCPDCEDCTSGHS 1596
              |.|::|...::.   ||....::..|..|.:|.|:.:      ..||.....|.|        
Human   119 CGQRQLRPGAGRRR---LQGPGGRRSGLRGPMAPPPAPL------LAPRPGETRPGC-------- 166

  Fly  1597 HANEQFEELQTLQAPPTVLTPPSTIVSVPS-------PQPMVYSQ-------HI----TMPSPEQ 1643
                        :.|.||......:...|.       .|..:|..       |:    .:|:.::
Human   167 ------------RKPGTVSFADVAVYFSPEEWGCLRPAQRALYRDVMQETYGHLGALGDVPNRKE 219

  Fly  1644 SEPDSTTTLRQYRKRGVIVGPQGPLHLATPVASPSPSSSPSSSTVDHIPPASPA-TPASPAPPPS 1707
            .||:.....:..||..|...|:     .....:|.|:.|.:.:...  ||.:.| .|.:.|.||:
Human   220 EEPEEVPRAKGPRKAPVKESPE-----VLVERNPDPAISVAPARAQ--PPKNAAWDPTTGAQPPA 277

  Fly  1708 PAVASTVQVSELRTSHHCLYCEERFTNEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRH 1772
            |..:...|..:.|  |.|..|..|||....|..|.::..|   ..|:.|..|...::.:.|:..|
Human   278 PIPSMDAQAGQRR--HVCTDCGRRFTYPSLLVSHRRMHSG---ERPFPCPECGMRFKRKFAVEAH 337

  Fly  1773 MESHDVEGRPYECNICRVRFPRPSQLTLHKITVH------LLSK--PHTCDECG 1818
            ...|      ..|:..| |..||....:.:..|.      :|.:  |...:|||
Human   338 QWIH------RSCSGGR-RGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368 5/14 (36%)
C2H2 Zn finger 1725..1746 CDD:275368 7/20 (35%)
C2H2 Zn finger 1756..1776 CDD:275368 4/19 (21%)
C2H2 Zn finger 1785..1806 CDD:275368 5/20 (25%)
C2H2 Zn finger 1814..1834 CDD:275368 3/5 (60%)
zf-C2H2 1839..1861 CDD:278523
C2H2 Zn finger 1841..1861 CDD:275368
C2H2 Zn finger 1868..1888 CDD:275368
ZNF688XP_024305933.1 KRAB 171..212 CDD:307490 6/40 (15%)
Zn-ribbon_8 <251..>318 CDD:321291 20/73 (27%)
zf-C2H2 291..313 CDD:306579 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-H2C2_2 306..330 CDD:316026 6/26 (23%)
C2H2 Zn finger 321..341 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.