DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and LOC102553962

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:XP_006230432.1 Gene:LOC102553962 / 102553962 RGDID:7731019 Length:460 Species:Rattus norvegicus


Alignment Length:422 Identity:102/422 - (24%)
Similarity:144/422 - (34%) Gaps:107/422 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1586 PDCEDC-TSGHSHANEQ------FEELQTLQ----------APPTVLTPPSTIVSVPSPQPMVYS 1633
            |:...| |..||...::      .||.:.:|          .|......|||.:.:.|       
  Rat    88 PELAMCKTEVHSDCRQEEKRRKPREETEAIQRTFSTEAGPKEPHLTFAAPSTNLDLLS------- 145

  Fly  1634 QHITMPSPEQSEPDS----TTTLRQYRKRGVIVGPQGPLHLATPVASPSPSSSPSSSTVDHIPPA 1694
                 ..|:|..|.|    ...||..::.|        .|    |...|.:..|  :.|:|:...
  Rat   146 -----KDPQQGPPTSGSVRARVLRANKRHG--------CH----VCGKSFAQRP--TLVEHLYTH 191

  Fly  1695 SPATPASPAPPPSPAVASTVQVSELRT------SHHCLYCEERFTNEISLKKH------------ 1741
            :...|.. .|..:........:|..|.      .|.|..||:.|:...:|..|            
  Rat   192 TGEKPFQ-CPECNKCFGRASSLSMHRAIHRGERPHRCPNCEKCFSQRSTLVAHLYTHTGERPFCC 255

  Fly  1742 ---------------HQLAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYECNICRVR 1791
                           |:..|  ....|:.|..|:|.:..|:||..|:..|..| :||.|..|..|
  Rat   256 PDCNKCFGRASSLSTHRAIH--RKERPHRCPYCERTFTQRSALTSHLRVHTGE-KPYCCADCGRR 317

  Fly  1792 FPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLKELR 1855
            |.|.|.|..|:..||....|.:|..||:.|.....|:.|::.| ||..|.|..|.|.|....|:.
  Rat   318 FSRSSGLHEHQRVVHSGMTPFSCTVCGRAFADSKYLRRHMRIHTGEKPYSCPDCGRCFRQGSEIA 382

  Fly  1856 KHRRTHS-EMFYKCKFCPSSFMRFTNFRAHMKTHLPLGVFRNEDAASKSPSNNNSHASSDKLENP 1919
            .|||||: |..|.|..|...|...:...:|...|.|......:..||:.     |.|.....|:|
  Rat   383 AHRRTHTGERPYPCPQCGRGFRTKSAMTSHQWVHRPGAKGHRDKKASQL-----SVALGTGQEDP 442

  Fly  1920 ATPIEETPLTPMSSGGHLYHSPDEYPNSVESC 1951
            ..|:          |..|      ||...:.|
  Rat   443 DPPV----------GFQL------YPEIFQEC 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 7/47 (15%)
C2H2 Zn finger 1756..1776 CDD:275368 7/19 (37%)
C2H2 Zn finger 1785..1806 CDD:275368 8/20 (40%)
C2H2 Zn finger 1814..1834 CDD:275368 6/19 (32%)
zf-C2H2 1839..1861 CDD:278523 9/21 (43%)
C2H2 Zn finger 1841..1861 CDD:275368 8/19 (42%)
C2H2 Zn finger 1868..1888 CDD:275368 4/19 (21%)
LOC102553962XP_006230432.1 KRAB 22..81 CDD:214630
KRAB 22..61 CDD:279668
COG5048 <171..385 CDD:227381 57/223 (26%)
C2H2 Zn finger 171..191 CDD:275368 6/25 (24%)
zf-H2C2_2 184..208 CDD:290200 4/24 (17%)
C2H2 Zn finger 199..219 CDD:275368 3/19 (16%)
zf-H2C2_2 211..236 CDD:290200 7/24 (29%)
C2H2 Zn finger 227..247 CDD:275368 6/19 (32%)
zf-H2C2_2 240..264 CDD:290200 2/23 (9%)
C2H2 Zn finger 255..275 CDD:275368 1/19 (5%)
zf-H2C2_2 267..292 CDD:290200 6/26 (23%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 295..320 CDD:290200 11/25 (44%)
C2H2 Zn finger 311..330 CDD:275368 8/18 (44%)
zf-C2H2 338..360 CDD:278523 6/21 (29%)
C2H2 Zn finger 340..360 CDD:275368 6/19 (32%)
zf-H2C2_2 352..377 CDD:290200 10/24 (42%)
C2H2 Zn finger 368..388 CDD:275368 8/19 (42%)
zf-H2C2_2 384..405 CDD:290200 10/20 (50%)
C2H2 Zn finger 396..416 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.