Sequence 1: | NP_001247289.1 | Gene: | mld / 2768685 | FlyBaseID: | FBgn0263490 | Length: | 1965 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_932128.2 | Gene: | E430018J23Rik / 101604 | MGIID: | 2141981 | Length: | 461 | Species: | Mus musculus |
Alignment Length: | 376 | Identity: | 87/376 - (23%) |
---|---|---|---|
Similarity: | 132/376 - (35%) | Gaps: | 119/376 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 1661 IVGPQ-GPLHLATPVASPSPS-SSPS--------SSTVDHIPPASPATPASPAPPPSPAVASTVQ 1715
Fly 1716 VSELRTSHHCLYCEERFTNEISLKKH---------------------------HQLAHGALTTMP 1753
Fly 1754 YVCTICKRGYRMRTALHRHMESHDVEGRPYECNICRVRFPRPSQLTLHKITVHLLSKPHTCDECG 1818
Fly 1819 KQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLKELRKHRR-THSEMF-YKCKFCPSSFMRFTN 1880
Fly 1881 FRAHMKTHLPLGVFRNEDAAS--KSPSNNNSHASSDKLENP------------------------ 1919
Fly 1920 -----------------ATPIEETPLTPMSSGGHLYHSPDEYPNSVESCAG 1953 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mld | NP_001247289.1 | zf-AD | 186..255 | CDD:214871 | |
C2H2 Zn finger | 1365..1388 | CDD:275368 | |||
C2H2 Zn finger | 1396..1416 | CDD:275368 | |||
C2H2 Zn finger | 1424..1445 | CDD:275368 | |||
C2H2 Zn finger | 1725..1746 | CDD:275368 | 6/47 (13%) | ||
C2H2 Zn finger | 1756..1776 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 1785..1806 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 1814..1834 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 1839..1861 | CDD:278523 | 9/22 (41%) | ||
C2H2 Zn finger | 1841..1861 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 1868..1888 | CDD:275368 | 6/19 (32%) | ||
E430018J23Rik | NP_932128.2 | KRAB | 22..81 | CDD:214630 | |
KRAB | 22..61 | CDD:279668 | |||
C2H2 Zn finger | 170..190 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 183..207 | CDD:290200 | 2/23 (9%) | ||
C2H2 Zn finger | 198..218 | CDD:275368 | 1/19 (5%) | ||
zf-H2C2_2 | 210..235 | CDD:290200 | 5/26 (19%) | ||
COG5048 | <223..383 | CDD:227381 | 52/161 (32%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 239..259 | CDD:290200 | 8/20 (40%) | ||
C2H2 Zn finger | 254..302 | CDD:275368 | 18/48 (38%) | ||
zf-H2C2_2 | 298..319 | CDD:290200 | 9/20 (45%) | ||
C2H2 Zn finger | 310..331 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 339..359 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 351..376 | CDD:290200 | 5/24 (21%) | ||
C2H2 Zn finger | 367..387 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 383..402 | CDD:290200 | 3/18 (17%) | ||
C2H2 Zn finger | 395..415 | CDD:275368 | 0/19 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167832244 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |