DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and E430018J23Rik

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_932128.2 Gene:E430018J23Rik / 101604 MGIID:2141981 Length:461 Species:Mus musculus


Alignment Length:376 Identity:87/376 - (23%)
Similarity:132/376 - (35%) Gaps:119/376 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1661 IVGPQ-GPLHLATPVASPSPS-SSPS--------SSTVDHIPPASPATPASPAPPPSPAVASTVQ 1715
            |:.|: ||:       .|.|| :|||        :|...|               |:.||.:.:.
Mouse   120 ILSPEAGPM-------EPRPSFASPSCNLELLFKNSQQGH---------------PTVAVHNPIL 162

  Fly  1716 VSELRTSHHCLYCEERFTNEISLKKH---------------------------HQLAHGALTTMP 1753
            .::.|  |.|..|.:.|.::..|.:|                           |:..|..  ..|
Mouse   163 KADQR--HGCHVCGKSFAHQSKLVEHLYTHTGEKPFQCPDCDKYFGRASSLSMHRAIHRG--ERP 223

  Fly  1754 YVCTICKRGYRMRTALHRHMESHDVEGRPYECNICRVRFPRPSQLTLHKITVHLLSKPHTCDECG 1818
            :.|..|.:.:..|:.|..||.:|..| :|:.|..|...|.|||.|:.|: .:|...:||.|.:||
Mouse   224 HQCPDCGKSFTQRSTLVAHMYTHTGE-KPFHCPDCNKSFSRPSSLSSHR-AIHRGERPHCCSDCG 286

  Fly  1819 KQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLKELRKHRR-THSEMF-YKCKFCPSSFMRFTN 1880
            :.|...|.|..|::.| ||..|.|..|.|.|.....||:|:| .||.:. :.|..|..:|.|...
Mouse   287 RAFTHRSGLIAHLRVHTGEKPYCCADCGRCFSQSSGLREHQRVVHSGVTPFTCTHCGRAFARAAY 351

  Fly  1881 FRAHMKTHLPLGVFRNEDAAS--KSPSNNNSHASSDKLENP------------------------ 1919
            .:.||:||.....:...|...  :..|:..:|..:...|.|                        
Mouse   352 LQCHMRTHTGEKPYSCPDCGRCFRQSSDMAAHRRTHSGERPYPCPQCGRRFPTKSAVTKHQWVHR 416

  Fly  1920 -----------------ATPIEETPLTPMSSGGHLYHSPDEYPNSVESCAG 1953
                             ..|.:|.|..|:..        ..||...:.|.|
Mouse   417 PGAKGHKDKKFSQLSISLDPSQEDPDPPVGF--------QHYPEIFQECGG 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 6/47 (13%)
C2H2 Zn finger 1756..1776 CDD:275368 6/19 (32%)
C2H2 Zn finger 1785..1806 CDD:275368 8/20 (40%)
C2H2 Zn finger 1814..1834 CDD:275368 7/19 (37%)
zf-C2H2 1839..1861 CDD:278523 9/22 (41%)
C2H2 Zn finger 1841..1861 CDD:275368 8/20 (40%)
C2H2 Zn finger 1868..1888 CDD:275368 6/19 (32%)
E430018J23RikNP_932128.2 KRAB 22..81 CDD:214630
KRAB 22..61 CDD:279668
C2H2 Zn finger 170..190 CDD:275368 5/19 (26%)
zf-H2C2_2 183..207 CDD:290200 2/23 (9%)
C2H2 Zn finger 198..218 CDD:275368 1/19 (5%)
zf-H2C2_2 210..235 CDD:290200 5/26 (19%)
COG5048 <223..383 CDD:227381 52/161 (32%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 239..259 CDD:290200 8/20 (40%)
C2H2 Zn finger 254..302 CDD:275368 18/48 (38%)
zf-H2C2_2 298..319 CDD:290200 9/20 (45%)
C2H2 Zn finger 310..331 CDD:275368 8/20 (40%)
C2H2 Zn finger 339..359 CDD:275368 6/19 (32%)
zf-H2C2_2 351..376 CDD:290200 5/24 (21%)
C2H2 Zn finger 367..387 CDD:275368 3/19 (16%)
zf-H2C2_2 383..402 CDD:290200 3/18 (17%)
C2H2 Zn finger 395..415 CDD:275368 0/19 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.