DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33342 and CG34444

DIOPT Version :10

Sequence 1:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster


Alignment Length:96 Identity:23/96 - (23%)
Similarity:42/96 - (43%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 TRVWLYDVVETGLERLGDRNAGACLLKCICEISQRPFMH-NSIFGEILNAVLVPS---LDNVPEK 182
            :|...|.::....|..|.....:|||:.|||.:...... |.:.|.:::.:..||   .:.:|::
  Fly   192 SRTKFYYIINHRFELHGLGAGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSSRYEELPKR 256

  Fly   183 YLHARNAGKAGANCRKTYSDCSKAFWNKLIQ 213
            |..|...|:.| ||......|..:..:.:.|
  Fly   257 YYIAELDGRNG-NCGGYRVQCEHSVLDMITQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33342NP_001097904.1 DM4_12 123..203 CDD:462285 21/83 (25%)
CG34444NP_001097313.1 DM4_12 193..276 CDD:462285 21/83 (25%)

Return to query results.
Submit another query.