DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33342 and CG34429

DIOPT Version :9

Sequence 1:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097598.1 Gene:CG34429 / 5740606 FlyBaseID:FBgn0085458 Length:249 Species:Drosophila melanogaster


Alignment Length:192 Identity:47/192 - (24%)
Similarity:76/192 - (39%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KIVAGLAFPIKQADTVQSVWGFVNYQAQYVPSPVPIYWWSFWNTSTFLSTAREWR-KGI----RS 115
            :::||...|.:.......:.|:|.....|:|                 .:|::.| |.:    .|
  Fly    55 QMIAGFGIPAEDLKVESVITGYVLKAQYYLP-----------------YSAKQLRTKDVHEISES 102

  Fly   116 RVFQDET---RVWLY---------DVVETGLERLGD-----------------RNAGACLLKCIC 151
            |:.|:.|   :|...         |:::..|:.||.                 .|...|:||.||
  Fly   103 RLLQNATIFDKVMQMSEQKLGFDPDILQEDLQALGSYRWSVYEAFTALAIRMKLNGRVCVLKSIC 167

  Fly   152 EISQRPF-MHNSIFGEILNAVLVP--SLDNVPE----KYLHARNAGKAGANCRKTYSDCSKA 206
            |.:..|| ..|.:.||:|:.:|.|  |:|.:.|    .||.|...|.||.:|.:.|..|.|:
  Fly   168 ESAAAPFDDRNGLLGEVLHILLTPSSSVDPLSEHSDNDYLQAERLGAAGGDCDQVYPRCPKS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 31/112 (28%)
CG34429NP_001097598.1 DM4_12 137..233 CDD:214785 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.