DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33342 and CG34443

DIOPT Version :9

Sequence 1:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 / 5740580 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster


Alignment Length:208 Identity:45/208 - (21%)
Similarity:80/208 - (38%) Gaps:48/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LSRTKRLAIFNGQGTNKIVAGLAFPIKQADTVQSVWGFVNYQAQYVPSPVPIYW--WSFWNT--- 99
            |..|.....|....|:.|.|.:|.|::...  ::|:...|::|.|   .:|..|  |:.:..   
  Fly    18 LDLTNSFVAFTASSTHGIFAAIAVPLELPH--RNVFVSYNFEANY---NLPANWEKWTIFQNGPI 77

  Fly   100 -------STFLSTAREWRKGIRSRVFQDE-------------------------TRVWLYDVVET 132
                   .|...|.|:...|.::...::|                         ||..:|.:...
  Fly    78 ESEEVVDETDTETDRKLAAGCQNCTVKEENEAGSEEVEEITEVLPQERKVRSLLTRSNIYRIFVD 142

  Fly   133 GLERLGDRNAGACLLKCICEISQRPF-MHNSIFGEILNAVLVPS---LDNVPEKYLHARNAGKAG 193
            .|:|.|.|.. :|||:.|||.|.... ..|.:.|.:::.:..||   .:::|.:|..|.:.|..|
  Fly   143 KLKRSGFRGE-SCLLRLICETSAAQLDEFNGVLGSLMHVLFSPSSSESEDLPLRYYQAEHDGWNG 206

  Fly   194 ANCRKTYSDCSKA 206
             :|......|.::
  Fly   207 -HCHVYEPGCGES 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 23/83 (28%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.