DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33342 and CG17780

DIOPT Version :9

Sequence 1:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:178 Identity:43/178 - (24%)
Similarity:76/178 - (42%) Gaps:35/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LSLSRTKR-LAIFNGQGTNKIVAGLAFPIKQADTVQSVWGF-VNYQAQYVPSPVPIYWWSF---W 97
            |...|.|| |.|..   |.:|..|: |.:.....:.|...| ||.:...:.||:.   |:.   :
  Fly   185 LIFRRAKRYLDIIE---TTRIFVGI-FQVIVNTYINSPLKFRVNAKNNVIKSPIV---WAHGYGF 242

  Fly    98 NTSTFLSTAREWRKGIRSRVFQDETRVWLYDVVE-TGLERLGDRNAGACLLKCICEISQRPFMHN 161
            ..:|.:...||      :|.|:.:|...|::::: :||:      ..||:||..|..........
  Fly   243 RANTPVLVKRE------NRPFRRDTYELLHELIDRSGLD------GRACVLKAYCTALAGDHGQG 295

  Fly   162 SIFGEILNAVLVPSLDNVPEKYL-HARNAGKAGANCRK-TYSDCSKAF 207
            .:| ::|..|.  :||...:::: |.|.     .||.: .:|.|..:|
  Fly   296 FLF-KLLKYVF--TLDEHDKRHMPHLRE-----ENCEQIMHSHCPLSF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 18/82 (22%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 1/2 (50%)
DM4_12 253..338 CDD:214785 24/103 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.