DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33342 and CG14115

DIOPT Version :9

Sequence 1:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster


Alignment Length:204 Identity:48/204 - (23%)
Similarity:78/204 - (38%) Gaps:50/204 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GLSLSRTKRLAIFNGQGTNKIVAGLAFPIKQADTVQSVWGFVNYQAQYVPSPVPIY--WWSFWNT 99
            ||||:..  ..:|..||:..::|.:|.|::...  ::|:...|:::.|.......|  |...|:.
  Fly    17 GLSLAHC--FLVFPRQGSFGLLAAVAIPLELGP--KNVYMAFNFESNYALPSNDSYNQWIDRWDL 77

  Fly   100 STFLSTAREWRKGIRSRV------------FQDE---------------TRVWLYDVVETGLERL 137
            .       :...|:...|            .|||               .|...|..:...|...
  Fly    78 D-------DHYLGVGGNVTPINARQDGGDFSQDEDNEVRRRSVGSPPPFRRHDFYRSIINFLTHY 135

  Fly   138 GDRNAGACLLKCICEISQRPF-MHNSIFGEILNAVLVPS-------LDNVPEKYLHARNAGKAGA 194
            | .|..||||:.|||:|:.|. ..|.:.|.:...:.:|:       |.:|.|.| .|.:||..|.
  Fly   136 G-FNGSACLLRTICEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELY-KASDAGTHGP 198

  Fly   195 NCRKTYSDC 203
            .|.:..:.|
  Fly   199 GCSEYVAHC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 26/87 (30%)
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 27/94 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.