DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33342 and CG7201

DIOPT Version :9

Sequence 1:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster


Alignment Length:102 Identity:35/102 - (34%)
Similarity:48/102 - (47%) Gaps:9/102 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VFQDETRVWLYDVVETGLERLGDRNAGACLLKCICEISQRPFMHNSIFGEILNAVLV----PSLD 177
            :|....||.||.|||..|...| .:..||||:.|||:..|......:|||:....|.    |..|
  Fly   200 IFHGGERVLLYGVVEDFLSTFG-MDGKACLLRTICEMHSRSLEKFGVFGEMTKLFLTVTKSPFSD 263

  Fly   178 NVPEKYLHARNAG---KAGANCRKTYSDCSKAFWNKL 211
            .||: |:.|:..|   :|...|...:.||.|:.:..|
  Fly   264 LVPD-YVQAQEVGEGKQAPGECFPYFKDCPKSIFKAL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 30/86 (35%)
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 34/98 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.