DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33342 and CG14826

DIOPT Version :9

Sequence 1:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster


Alignment Length:202 Identity:63/202 - (31%)
Similarity:96/202 - (47%) Gaps:15/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLLLFVLAASAAGDGNDRNASPGLSLSRTKRLAIFNGQGTNKIVAGLAFPIKQADTVQSVWGFVN 79
            :|.:.:|:..:.|| :.||.:..:. .|.||..|:...|:.|...|.:.||...|.|......::
  Fly     8 LLAVAMLSLPSRGD-SSRNLTEFMG-HRQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLS 70

  Fly    80 YQAQ---YVPSPVPIYWWSFWNTSTFLSTAREWRKGIRSRV------FQDETRVWLYDVVETGL- 134
            |..|   |.....||:.|..|. .||..:..:.|:.|...|      :.|:.|:.:|..:|..: 
  Fly    71 YTLQGGSYSLPTSPIWPWDKWE-GTFARSLMQMRRNIERHVANGGVRYADDARLLVYTALEEYMG 134

  Fly   135 ERLGDRNAG-ACLLKCICEISQRPFMHNSIFGEILNAVLVPSLDNVPEKYLHARNAGKAGANCRK 198
            .|..||:.| .|||:.|||.:| ...|..:|.||::.||.|...::...|..|..||:|||||..
  Fly   135 RRNNDRSMGRQCLLRSICENAQ-IHHHIGVFSEIMDIVLSPGKADLDNDYHDAYAAGRAGANCLG 198

  Fly   199 TYSDCSK 205
            .||.|.:
  Fly   199 LYSACPR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 32/81 (40%)
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449132
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E2BX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116663at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6482
65.850

Return to query results.
Submit another query.