DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33342 and CG13869

DIOPT Version :9

Sequence 1:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster


Alignment Length:202 Identity:61/202 - (30%)
Similarity:97/202 - (48%) Gaps:30/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLLLFVLAASAAGDGNDRNASPGLSLSRTKRLAIFNGQGTNKIVAGLAFP---IKQADTVQSVWG 76
            :|.||.|.|.:|   .:.|.:......|.||..|:...|..|.|:|.|||   :::....|.|| 
  Fly     8 ILFLFTLEAVSA---LEANLTSWRHHRRQKRFLIYQNGGVIKFVSGCAFPAPFMEKKAWRQLVW- 68

  Fly    77 FVNYQAQYVPSPVPIYWWSFWNTSTFLSTAREWRKG---------IRSRVFQDETRVWLYDVVET 132
            .:|:..|:.....|||||..|:.|..|       ||         :.:|:..||.::.|:...|.
  Fly    69 LMNFHYQFNEPQTPIYWWKLWDGSRNL-------KGPLTQPAPPSVPARLLVDEPQLLLFKFAEA 126

  Fly   133 GLERLGDRNAGACLLKCICEISQRPFMHNSIFGEILNAVLVP--SLDNVPEKYLHARNAGKAGAN 195
            .:.:|| :|..|||.:.|||..|.. .|:.::.::|:.:|.|  :||   .:||.|...|:.|.:
  Fly   127 YMNQLG-QNGSACLDRLICENGQVD-EHSGLYAQLLHRLLRPHQTLD---VRYLDAYRMGRHGVD 186

  Fly   196 CRKTYSD 202
            ||..:.:
  Fly   187 CRNAFPE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 25/82 (30%)
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449134
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E2BX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116663at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.