DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33342 and CG33262

DIOPT Version :9

Sequence 1:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster


Alignment Length:199 Identity:59/199 - (29%)
Similarity:87/199 - (43%) Gaps:48/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SRTKRLAIFNGQG--TNKIVAGLAFPIKQAD------TVQSVWGFVNYQAQYVPSPVPIY----W 93
            ||:||..||..|.  .::.:||:..|   ||      ||    |:|.....|:|....:|    .
  Fly    28 SRSKRFLIFPRQAPTRHQFIAGIGIP---ADLEYESLTV----GYVLKAEYYLPYNATVYRQNPL 85

  Fly    94 WSFWNTSTFLSTAREWRKGIRSRVFQDETRV-W-LYDVVETGLERLGDRNAGACLLKCICEISQR 156
            :..:..:|.  .|::.||     :|...|.: | ||..:|..|...| .|..||||:.|||.:..
  Fly    86 FPEYKPNTI--DAQDQRK-----LFMKPTDLRWQLYQFIEHMLNGYG-LNGHACLLEAICEANNI 142

  Fly   157 PFMHN-SIFGEILNAVLVPS--LDNVPEKYLHARNAGKAGANCRKTYSDCSK-----------AF 207
            .|..: |..||:|:.:|.||  |::...:.|....|.|.|:.     .||||           :|
  Fly   143 KFAKDFSTAGEMLHLLLSPSSTLNSESNRALDFILAEKDGSR-----RDCSKYDCNTKIINWFSF 202

  Fly   208 WNKL 211
            .||:
  Fly   203 VNKM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 27/84 (32%)
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 31/87 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.