DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33340 and CG12861

DIOPT Version :9

Sequence 1:NP_996281.1 Gene:CG33340 / 2768682 FlyBaseID:FBgn0053340 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_610978.2 Gene:CG12861 / 36628 FlyBaseID:FBgn0033953 Length:239 Species:Drosophila melanogaster


Alignment Length:226 Identity:69/226 - (30%)
Similarity:92/226 - (40%) Gaps:63/226 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CVRFASGCEKKGPSRCPKVLTKFPCGKPNLQAPPKKKRKMVKAQSMWLNPFCDPDDTACPFNPRF 86
            |.:.||..:||             |..|.|..|   |.:.:             ||.........
  Fly    52 CYKAASRNDKK-------------CHPPVLPLP---KMECI-------------DDPCAESEMPL 87

  Fly    87 DDIYYVESDKAKRKYWQTWVAC---PPIQIKPKKICCFAKAKPAPIKRRKPSAKPSTA---C--- 142
            |..:|..||||.|||.:||..|   |...:|.:|  |:      |.:.|:....|..:   |   
  Fly    88 DLDHYTPSDKAARKYQRTWCECYMIPKAAVKARK--CY------PNRPRRKFECPRVSDVECRWD 144

  Fly   143 PQPCPDPSED-----LCPRLAR---------RCHRDGRRPPSCRRERGPLPCVKPRTPYPSFSEC 193
            |.||.|..:.     ..||:.:         .| ||||.||||...|.|..|.|.||.|||||||
  Fly   145 PMPCDDVKKKPEILIEVPRIGKWPCCKIPTPGC-RDGRIPPSCDAGRIPTCCKKRRTKYPSFSEC 208

  Fly   194 RRLKPDAPPLKECNCLAKPLLCEIWAEFRRR 224
            ::...|  |:..|.|..|..:|:::|.||.:
  Fly   209 KKELLD--PIPPCECEKKVNMCDVYAYFRHK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33340NP_996281.1 DUF1431 73..223 CDD:284625 58/172 (34%)
CG12861NP_610978.2 DM6 74..235 CDD:214775 57/184 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.