DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33340 and CG11635

DIOPT Version :9

Sequence 1:NP_996281.1 Gene:CG33340 / 2768682 FlyBaseID:FBgn0053340 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_610372.1 Gene:CG11635 / 35808 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster


Alignment Length:231 Identity:68/231 - (29%)
Similarity:89/231 - (38%) Gaps:57/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SGCEKKGPSRCPKVLTKFPCGKPNLQAPPKK---KRKMV---------------KAQSMWLNP-- 71
            ||...| |.:.|.     |...|:..:|||.   ||:..               |.:|||..|  
  Fly    15 SGSSNK-PPKPPS-----PPKPPSSPSPPKSPSAKRECKIRTHCIPAAFCAEGDKFKSMWDPPKN 73

  Fly    72 ---------------FCDPDDTACPFNPRFDDIYYVESDKAKRKYWQTWVACPPIQIKPKKICCF 121
                           .|:|:.|. |. |.||::||..|.| ...|.:.||.||...|:.|.||.:
  Fly    74 LPPPYPFVVSRSNDLCCEPNCTK-PL-PSFDELYYRPSCK-NGPYQRHWVECPKFMIRKKIICAY 135

  Fly   122 AKAKPAPIKRRKPSAKPSTACPQPCPDPSEDLCPRLA--RRCHRDGRRPPSCRRERGPLPCVKPR 184
            .|.:.....||....:..|........|    ||..|  .|| ..|||||.|...:.|..|.:..
  Fly   136 DKLEALSPARRVAERRERTTLSATATGP----CPHFAPLARC-VPGRRPPRCHAAKTPSCCRRLC 195

  Fly   185 TPYPSFSECRRLK----PDAPPLKECNCLAKPLLCE 216
            .|.|.:|:|::.|    |..|  :||.|.....|||
  Fly   196 APMPCWSDCKQPKLAKRPYRP--RECECRFPLSLCE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33340NP_996281.1 DUF1431 73..223 CDD:284625 51/150 (34%)
CG11635NP_610372.1 DM6 88..235 CDD:214775 51/152 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.