DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33340 and hubl

DIOPT Version :9

Sequence 1:NP_996281.1 Gene:CG33340 / 2768682 FlyBaseID:FBgn0053340 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001286194.1 Gene:hubl / 246567 FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster


Alignment Length:273 Identity:79/273 - (28%)
Similarity:111/273 - (40%) Gaps:69/273 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLFRPIFGAVNSC--VRFASGCEKKGPSRCP-------KVLTKFPCG------KP---------- 49
            ||...:....::|  :...:...:.|...||       ||:.|.||.      :|          
  Fly    10 VLMPSLIALEDTCRTIHVTALMARMGKDFCPVSEVPDCKVVKKRPCSPTDPPVRPCSEEGCTQPR 74

  Fly    50 -----------NLQAPPKKKRKMV------------KAQSMWLNPFCDPDDTACP--FNPRFDDI 89
                       |..|.|.||.|.|            :.::||..|     :..||  .:.|||.:
  Fly    75 YSCCVSTGISANPCADPSKKTKFVSMWKRYKDDGSNRPEAMWHYP-----EECCPKCEDTRFDVL 134

  Fly    90 YYVESDKAKRKYWQTWVACPPIQIKPKKICCFAKAKPAPIKRRKPSAKPSTAC-------PQPCP 147
            ||..|||. |::.:||..|.| ::.||::||:..|.|..:.||.....|.:||       ...|.
  Fly   135 YYTPSDKC-REFQRTWWECCP-KMVPKRVCCWCDAIPPEVLRRDLPICPRSACLAEHERKRYKCL 197

  Fly   148 DPSEDLCPRLARRCHRDGRRPPSCRRERGPLPCVKPRTPYPSFSECRRLKPDAPPLK--ECNCLA 210
            :.....|.|:...|.|..|.||.||...||..|.|.:.|:||:|||.:..|...|.:  ||.||.
  Fly   198 NKRYKGCMRIRMPCCRTARIPPDCRAFPGPSDCEKIKCPFPSYSECVQEDPAVIPTRPPECECLK 262

  Fly   211 KPLLCEIWAEFRR 223
            |...||   :.||
  Fly   263 KASQCE---QIRR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33340NP_996281.1 DUF1431 73..223 CDD:284625 55/160 (34%)
hublNP_001286194.1 DUF1431 126..275 CDD:284625 55/152 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.