DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33339 and CG33341

DIOPT Version :9

Sequence 1:NP_996280.2 Gene:CG33339 / 2768681 FlyBaseID:FBgn0053339 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_996282.1 Gene:CG33341 / 2768683 FlyBaseID:FBgn0053341 Length:306 Species:Drosophila melanogaster


Alignment Length:341 Identity:82/341 - (24%)
Similarity:150/341 - (43%) Gaps:77/341 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSTILVLLLI-----GAIRAAIGNQTHLVGSSLENRILSRRVRALVFPDKASLLLTAALTKLIL 60
            :|:.|.:||::     .::.|..|.........:..|:.|||.||::||..:.:..|.:....:|
  Fly     2 LRAKIFILLVLYTAFGPSLVAYQGKSNKKELKDVVPRVFSRRKRAVLFPPGSFVKFTCSFATGLL 66

  Fly    61 GGRPSGLQYSLEFDMYVPVPDTIEGWQPKILKKMKP-----KPMSTPKR-----RYDWSYS---- 111
            ...|.|:.:.||..:|.|:|..:|...|   ||.:|     ||...|:.     ..||.:.    
  Fly    67 AAYPKGISFVLEEAVYFPIPGAVEDIYP---KKFRPKTTTKKPEKLPETIVYIPGTDWRFKAQTL 128

  Fly   112 KRPESYYP----------YYADPYRNAHYESPANNHRVPF--YQATSRDSFPQASWHSSSPTNRR 164
            .:|:...|          .||:||:..::     |.::.:  ||....|| .:|.|         
  Fly   129 PKPKWRQPPPKTHRIDDDSYANPYKWQNW-----NQKLKWDTYQWKEGDS-NKAKW--------- 178

  Fly   165 KEFYTSRPSLNRASFYHSPWSLSANQRNSYPPEEEVYESWDQVPSWKLHRGYRERREIFDQLEAM 229
            .::.|..|.      :.|.|:     :|.|.      .:|..    :.:.|:|:||.:||:...:
  Fly   179 SKWTTPSPK------WESKWN-----QNKYS------GAWQS----QHYHGHRDRRSLFDRFTKL 222

  Fly   230 GKVFQLDLRSCIKRAMCELRAKLNAGQDQGF-LMEDLMRIVLTVPE-EVADDKYRHRMDN--QDC 290
            ..:..:|::|||.|::|:.:..|   ...|: :::|::|:|.|:|. :..:|:|...||.  .:|
  Fly   223 SSLIGIDVKSCILRSICDSKRLL---LPPGYSMLQDMLRVVFTLPRLDGLEDEYSRLMDKDADEC 284

  Fly   291 ARFYAPSCPYNVLDFL 306
            |......|..|:|.:|
  Fly   285 AAELKSKCNMNLLIWL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33339NP_996280.2 DM4_12 215..305 CDD:214785 28/93 (30%)
CG33341NP_996282.1 DM4_12 212..292 CDD:285126 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010001
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.