DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myo95E and CG31638

DIOPT Version :9

Sequence 1:NP_001027208.1 Gene:Myo95E / 2768680 FlyBaseID:FBgn0039157 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_723186.2 Gene:CG31638 / 33910 FlyBaseID:FBgn0051638 Length:704 Species:Drosophila melanogaster


Alignment Length:237 Identity:46/237 - (19%)
Similarity:78/237 - (32%) Gaps:62/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QSEDQCVLLTGESGAGKTETFKMIVNFLTHIQDR------------------------SHCPPTP 128
            :|.|:.|        |:||..::.:.   |:|:|                        :.|.|..
  Fly   472 RSNDELV--------GQTEGLQVQIQ---HLQNRRAPSPQLRGMGGVQLRNKIAVELPNDCLPNI 525

  Fly   129 NVLRKQSSTSSASGLVMHAHRRASSSCSGTANFIICKNRAENPSGSVSRRQSPSPGPSQRSRTRA 193
            |.|| |....|.:|| ..:|..:.::....|:   .|..:......:.::||.:...:..:...|
  Fly   526 NDLR-QIFDDSQAGL-RSSHNGSDAAMHHAAS---VKRSSHTERTLLQQQQSSAAASAAAAAAAA 585

  Fly   194 ESIERQSRRHMREKIVD-----FDFSHHKSSENISGLPESHAHHMHPTKSCFKHQQTQVSACTAM 253
            .:.......|:.|.|.:     .:|...|..     ....|..|.|       |.|.|.|.....
  Fly   586 AAFFDAKPTHLEENIFESKSRNLEFERAKQK-----FDNPHGQHHH-------HHQRQRSGNGRY 638

  Fly   254 PAAAKGSPK--YAVP---TVYGGCRQCGHSKCVRAQSLEKEE 290
            .:|...:.:  .|:|   |..||.........:..|..|||:
  Fly   639 GSAGSSASRANLALPLKGTTNGGSSSVSSKDELNRQLYEKEQ 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myo95ENP_001027208.1 Motor_domain 19..>118 CDD:277568 6/29 (21%)
Motor_domain 403..924 CDD:277568
Myosin_TH1 1092..1267 CDD:283635
CG31638NP_723186.2 DUF4201 284..457 CDD:290581
Ax_dynein_light <300..369 CDD:287215
RILP-like <312..448 CDD:304877
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.