DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myo95E and CG31638

DIOPT Version :10

Sequence 1:NP_001027208.1 Gene:Myo95E / 2768680 FlyBaseID:FBgn0039157 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_723186.2 Gene:CG31638 / 33910 FlyBaseID:FBgn0051638 Length:704 Species:Drosophila melanogaster


Alignment Length:237 Identity:46/237 - (19%)
Similarity:78/237 - (32%) Gaps:62/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QSEDQCVLLTGESGAGKTETFKMIVNFLTHIQDR------------------------SHCPPTP 128
            :|.|:.|        |:||..::.:.   |:|:|                        :.|.|..
  Fly   472 RSNDELV--------GQTEGLQVQIQ---HLQNRRAPSPQLRGMGGVQLRNKIAVELPNDCLPNI 525

  Fly   129 NVLRKQSSTSSASGLVMHAHRRASSSCSGTANFIICKNRAENPSGSVSRRQSPSPGPSQRSRTRA 193
            |.|| |....|.:|| ..:|..:.::....|:   .|..:......:.::||.:...:..:...|
  Fly   526 NDLR-QIFDDSQAGL-RSSHNGSDAAMHHAAS---VKRSSHTERTLLQQQQSSAAASAAAAAAAA 585

  Fly   194 ESIERQSRRHMREKIVD-----FDFSHHKSSENISGLPESHAHHMHPTKSCFKHQQTQVSACTAM 253
            .:.......|:.|.|.:     .:|...|..     ....|..|.|       |.|.|.|.....
  Fly   586 AAFFDAKPTHLEENIFESKSRNLEFERAKQK-----FDNPHGQHHH-------HHQRQRSGNGRY 638

  Fly   254 PAAAKGSPK--YAVP---TVYGGCRQCGHSKCVRAQSLEKEE 290
            .:|...:.:  .|:|   |..||.........:..|..|||:
  Fly   639 GSAGSSASRANLALPLKGTTNGGSSSVSSKDELNRQLYEKEQ 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myo95ENP_001027208.1 Motor_domain 3..>123 CDD:473979 9/58 (16%)
Motor_domain <403..937 CDD:473979
Myosin_TH1 1092..1288 CDD:461801
CG31638NP_723186.2 Smc <233..>496 CDD:440809 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.