DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myo95E and Myo7a

DIOPT Version :10

Sequence 1:NP_001027208.1 Gene:Myo95E / 2768680 FlyBaseID:FBgn0039157 Length:1288 Species:Drosophila melanogaster
Sequence 2:XP_006229804.1 Gene:Myo7a / 266714 RGDID:628830 Length:2276 Species:Rattus norvegicus


Alignment Length:40 Identity:10/40 - (25%)
Similarity:20/40 - (50%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRNKKKHAAEQSNDLSDDETSNDNASTYSCHSETQLGDGG 41
            |..|:|.|::::...|...|::.....:|.....::.|||
  Rat    90 PWMKEKKASKKNQTTSTAATTDPGPLYFSPQGSPEISDGG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myo95ENP_001027208.1 Motor_domain 3..>123 CDD:473979 9/39 (23%)
Motor_domain <403..937 CDD:473979
Myosin_TH1 1092..1288 CDD:461801
Myo7aXP_006229804.1 MYSc_Myo7 140..790 CDD:276832
DUF5401 <835..>991 CDD:375164
MAP7 <918..>996 CDD:461709
MyTH4 1078..1314 CDD:214535
FERM1_F1_Myosin-VII 1318..1416 CDD:340612
B41 1320..1535 CDD:214604
FERM_C1_MyoVII 1529..1665 CDD:270019
SH3_MYO7A 1666..1730 CDD:212814
MyTH4 1808..1957 CDD:214535
FERM2_F1_Myosin-VII 1962..2059 CDD:340613
B41 1964..2176 CDD:214604
FERM_C2_MyoVII 2172..2267 CDD:270020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.