DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myo95E and hum-8

DIOPT Version :10

Sequence 1:NP_001027208.1 Gene:Myo95E / 2768680 FlyBaseID:FBgn0039157 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001294574.1 Gene:hum-8 / 176872 WormBaseID:WBGene00002041 Length:1279 Species:Caenorhabditis elegans


Alignment Length:103 Identity:27/103 - (26%)
Similarity:38/103 - (36%) Gaps:33/103 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 AALGLLCFVGVDDLGEILPLM--------KV----LHSIFAGSFLKGDNSPSGASSEAGAL---- 221
            |.||::    |..:|..:|.:        ||    :|.:....||....:||..|.|...|    
 Worm   423 ATLGIV----VGTIGTAVPWLFPGIFTRDKVVTSEMHKVIIPYFLALSITPSTHSLEGTLLAGRD 483

  Fly   222 -------HSAALSAWSLLLTLLPPGEF------VALLG 246
                   .:..|:...|||.||..|.|      .||:|
 Worm   484 LRYISLSMTGCLAVAGLLLMLLSNGGFGLRGCWYALVG 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myo95ENP_001027208.1 Motor_domain 3..>123 CDD:473979
Motor_domain <403..937 CDD:473979
Myosin_TH1 1092..1288 CDD:461801
hum-8NP_001294574.1 MYSc_Myo6 143..825 CDD:276833 27/103 (26%)
CBD_MYO6-like 836..987 CDD:409646
tolA_full 983..>1076 CDD:274303
MyUb_Myo6 1099..1139 CDD:439319
Myosin-VI_CBD 1180..1276 CDD:465157
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.