DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and SLT2

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_011895.1 Gene:SLT2 / 856425 SGDID:S000001072 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:346 Identity:123/346 - (35%)
Similarity:202/346 - (58%) Gaps:26/346 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YEFVRFLGGGSFGQVAKVRL--RGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHM-NHRNVIS 81
            ::.::.:|.|::|.|...|.  ...:...|:|::...|.:....|.:.||::||:|. .|:|:..
Yeast    23 FQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITC 87

  Fly    82 LLN---VFHPPAHNMMEFQQVYLVTHLMDADLHRYSRS-KRMSDQEIRIILYQILRGLKYIHSAG 142
            |.:   ||:|..    ....:||...||:.|:|:..:| :.::|...:...||||.||||||||.
Yeast    88 LYDMDIVFYPDG----SINGLYLYEELMECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSAD 148

  Fly   143 VVHRDLKPCNIAVNGNSEVRILDFGLSRMCADK-------MTDHVGTMWYLAPEIIFLRGQYTKA 200
            |:||||||.|:.||.:.:::|.||||:|..::.       :|::|.|.||.||||:.....||||
Yeast   149 VLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKA 213

  Fly   201 IDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRC 265
            |||||.||||||.:..:.:|:|::||:|:..::.::|||..|.:..|..:..::|:.......:.
Yeast   214 IDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKV 278

  Fly   266 DFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAPVYDQNFE--- 327
            .|.:|:...:.||:||:|:||...|:||||..||:.||||....:|   |::  ||..:.||   
Yeast   279 PFVNLYPNANSQALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDP---ADE--PVCSEKFEFSF 338

  Fly   328 NMVLPVKCWKELVSHEIRNFR 348
            ..|..::..|::|..|:::||
Yeast   339 ESVNDMEDLKQMVIQEVQDFR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 123/346 (36%)
S_TKc 20..305 CDD:214567 109/298 (37%)
SLT2NP_011895.1 STKc_MPK1 22..355 CDD:173750 120/340 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.