DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and SMK1

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_015379.1 Gene:SMK1 / 856167 SGDID:S000006258 Length:388 Species:Saccharomyces cerevisiae


Alignment Length:362 Identity:116/362 - (32%)
Similarity:194/362 - (53%) Gaps:42/362 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PDIYEFVRFLGGGSFGQVAKVRLRGTE--NYFAMKRLMRPFEREEDAKGTYREIRLLKHMN---- 75
            |..||.::|||.|::|.|..|:.:|..  ...|:|::...|.:|...|   |.||.||.||    
Yeast    35 PGYYEIIQFLGKGAYGTVCSVKFKGRSPAARIAVKKISNIFNKEILLK---RAIRELKFMNFFKG 96

  Fly    76 HRNVISLLN---VFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSK-RMSDQEIRIILYQILRGLK 136
            |:|:::|::   |...|      :..:|....|:|.||.:...|. ::|:..|:..|||||.|||
Yeast    97 HKNIVNLIDLEIVTSSP------YDGLYCYQELIDYDLAKVIHSSVQLSEFHIKYFLYQILCGLK 155

  Fly   137 YIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSR-------MC----ADKMTDHVGTMWYLAPEI 190
            |||||.|:||||||.||....|..::|.||||:|       .|    ...:|::|.|.||.|||:
Yeast   156 YIHSADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFKCHSTVQPHITNYVATRWYRAPEL 220

  Fly   191 IFLRGQYTKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNY 255
            :.....|:|::|:|:|||||||....:.:|.|.:.:.||..:|.::|||.::.:......::.|.
Yeast   221 LLSNQPYSKSVDIWAVGCILAEFYARKPVFMGRDSMHQIFEIIKVLGTPDKDILIKFGTIKAWNL 285

  Fly   256 --LEGYPLRQRCDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDT 318
              ....|:.::..:.::|.....:||:|:|.:|......|:...:|:.||:|.::.:|     |.
Yeast   286 GKNSNNPVYKKIPWSNIFPFASHEAINLIESLLHWDSTHRLNVEQAISHPFLNEVRKP-----DD 345

  Fly   319 APV-----YDQNFENMVLPVKCWKELVSHEIRNFRPD 350
            .||     :|..:|:.:..:...::.:..|::||:.|
Yeast   346 EPVCLQGPFDFTYESELNSMSKLRDYLVEEVKNFKTD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 115/359 (32%)
S_TKc 20..305 CDD:214567 104/307 (34%)
SMK1NP_015379.1 PKc_like 37..376 CDD:419665 111/352 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.