DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and KDX1

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_012761.1 Gene:KDX1 / 853696 SGDID:S000001644 Length:433 Species:Saccharomyces cerevisiae


Alignment Length:323 Identity:113/323 - (34%)
Similarity:185/323 - (57%) Gaps:28/323 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ENYFAMKRLMRPFEREEDAKGTYREIRLLKHM-NHRNVISLLN---VFHPPAHNMMEFQQVYLVT 103
            |.:.|::::...|..:...|.|.||::||:|: .|.|::.|.:   ||:|..    ....|||..
Yeast    48 ETHVAIRKIPNAFGNKLSCKRTLRELKLLRHLRGHPNIVWLFDTDIVFYPNG----ALNGVYLYE 108

  Fly   104 HLMDADLHRYSRS-KRMSDQEIRIILYQILRGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFG 167
            .||:.||.:..|| :|:.|...:..:||||..|||||||.|:|.||||.|:.||.:.:::|.:||
Yeast   109 ELMECDLSQIIRSEQRLEDAHFQSFIYQILCALKYIHSANVLHCDLKPKNLLVNSDCQLKICNFG 173

  Fly   168 LSRMCA----DKMTD-----HVGTMWYLAPEIIFLRGQYTKAIDVWSVGCILAELITDRVLFRGE 223
            ||  |:    .|:.|     ::.::||.||||:....:.|||:|:||.|||||||:..:.:|.|:
Yeast   174 LS--CSYSENHKVNDGFIKGYITSIWYKAPEILLNYQECTKAVDIWSTGCILAELLGRKPMFEGK 236

  Fly   224 NYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCDFHHLFMGYDVQAIDLMEKMLEM 288
            :||..:..::.|:|||..|.:..|:.::..||:..:.......|..:..|.:.:|::|::||||.
Yeast   237 DYVDHLNHILQILGTPPEETLQEIASQKVYNYIFQFGNIPGRSFESILPGANPEALELLKKMLEF 301

  Fly   289 VPEKRITAAEAMLHPYL---RDLIEPHHHAEDTAPVYDQNFENMVLPVKCWKELVSHEIRNFR 348
            .|:||||..:|:.||||   .| |:.....:.|   :...||::....:...|::. |:.:||
Yeast   302 DPKKRITVEDALEHPYLSMWHD-IDEEFSCQKT---FRFEFEHIESMAELGNEVIK-EVFDFR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 113/323 (35%)
S_TKc 20..305 CDD:214567 102/275 (37%)
KDX1NP_012761.1 STKc_MPK1 22..355 CDD:173750 110/317 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4864
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.