DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and KSS1

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_011554.3 Gene:KSS1 / 852931 SGDID:S000003272 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:360 Identity:122/360 - (33%)
Similarity:204/360 - (56%) Gaps:32/360 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WEFPDIYEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMN-HR 77
            ::.|..|:.|..:|.|::|.|.....:.:....|:|:: :||.::.....|.|||:||::.: |.
Yeast     7 FDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKI-QPFSKKLFVTRTIREIKLLRYFHEHE 70

  Fly    78 NVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSKR-----MSDQEIRIILYQILRGLKY 137
            |:||:|:...|.  ::.:...||||..||:.||.:...::.     :||..::...|||||.||.
Yeast    71 NIISILDKVRPV--SIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKS 133

  Fly   138 IHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADK----------MTDHVGTMWYLAPEIIF 192
            ||||.|:|||:||.|:.:|.|.::::.||||:|..|..          ||::|.|.||.||||:.
Yeast   134 IHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIML 198

  Fly   193 LRGQYTKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLE 257
            ...:||.|:|:||.||||||:::.:.||.|.:|..|:..::.::|||:.|....|..:|::.|:.
Yeast   199 TFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIA 263

  Fly   258 GYPLRQRCDFHHLFMGYDV--QAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAP 320
            ..|:|....:..::...|:  ..|||::|||:..|:|||:||||:.||||....:|....|....
Yeast   264 NLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEPEYPPL 328

  Fly   321 VYDQNF---ENMVL--------PVKCWKELVSHEI 344
            ..|..|   :|.::        |::..|:::..|:
Yeast   329 NLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLYDEL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 122/360 (34%)
S_TKc 20..305 CDD:214567 111/302 (37%)
KSS1NP_011554.3 PKc_like 7..365 CDD:419665 122/360 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.