DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MPK15

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_565070.2 Gene:MPK15 / 843702 AraportID:AT1G73670 Length:576 Species:Arabidopsis thaliana


Alignment Length:349 Identity:125/349 - (35%)
Similarity:192/349 - (55%) Gaps:23/349 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLN 84
            |:....:|.||:|.|.......|....|:|::...|:...||....|||:||:.:.|.:|:.:.:
plant    90 YQIQEVVGKGSYGVVGSAIDTHTGERVAIKKINDVFDHISDATRILREIKLLRLLLHPDVVEIKH 154

  Fly    85 VFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSK-RMSDQEIRIILYQILRGLKYIHSAGVVHRDL 148
            :..||:..  ||:.||:|..||::|||:..::. .::.:..:..|||:||||||:|:|.|.||||
plant   155 IMLPPSRR--EFRDVYVVFELMESDLHQVIKANDDLTPEHHQFFLYQLLRGLKYVHAANVFHRDL 217

  Fly   149 KPCNIAVNGNSEVRILDFGLSRM------CADKMTDHVGTMWYLAPEII--FLRGQYTKAIDVWS 205
            ||.||..|.:.:::|.||||:|:      .|...||:|.|.||.|||:.  |. .:||.|||:||
plant   218 KPKNILANADCKLKICDFGLARVSFNDAPTAIFWTDYVATRWYRAPELCGSFF-SKYTPAIDIWS 281

  Fly   206 VGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCDFHHL 270
            ||||.||::..:.||.|:|.|.|:..:.:.:|||..|.|:.|..:::|.||.....:|...|...
plant   282 VGCIFAEMLLGKPLFPGKNVVHQLDIMTDFLGTPPPEAISKIRNDKARRYLGNMRKKQPVPFSKK 346

  Fly   271 FMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLI----EPHHHAEDTAPV--YDQNFENM 329
            |...|..|:.|:|:::...|:.|.:|.||:..||...|.    ||     .|.|:  .:..||..
plant   347 FPKADPSALRLLERLIAFDPKDRPSAEEALADPYFNGLSSKVREP-----STQPISKLEFEFERK 406

  Fly   330 VLPVKCWKELVSHEIRNFRPDQLD 353
            .|.....:||:..||..:.|..|:
plant   407 KLTKDDIRELIYREILEYHPQMLE 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 123/343 (36%)
S_TKc 20..305 CDD:214567 110/293 (38%)
MPK15NP_565070.2 STKc_TDY_MAPK 89..426 CDD:143364 123/343 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.