DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MPK2

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_564746.1 Gene:MPK2 / 842248 AraportID:AT1G59580 Length:376 Species:Arabidopsis thaliana


Alignment Length:341 Identity:130/341 - (38%)
Similarity:204/341 - (59%) Gaps:11/341 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ESLWEFPDIYEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMN 75
            ::|:|....|..::.:|.|::|.|.....|.:....|:|::...||...||..|.||::||:|:.
plant    23 QTLFEIDTKYVPIKPIGRGAYGVVCSSVNRESNERVAIKKIHNVFENRIDALRTLRELKLLRHLR 87

  Fly    76 HRNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSKR-MSDQEIRIILYQILRGLKYIH 139
            |.||::|.:|.  .|::...|:.||||..|||.|||:..:|.: :|:...:..|:|:||||||||
plant    88 HENVVALKDVM--MANHKRSFKDVYLVYELMDTDLHQIIKSSQVLSNDHCQYFLFQLLRGLKYIH 150

  Fly   140 SAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADK---MTDHVGTMWYLAPEIIFLRGQYTKAI 201
            ||.::||||||.|:.||.|.:::|.||||:|....|   ||::|.|.||.|||::.....|..:|
plant   151 SANILHRDLKPGNLLVNANCDLKICDFGLARTSNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSI 215

  Fly   202 DVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCD 266
            ||||||||.|||:..:.:|.|...::||:.:|||:|:...|.:..|...:::.|:|..|......
plant   216 DVWSVGCIFAELLGRKPVFPGTECLNQIKLIINILGSQREEDLEFIDNPKAKRYIESLPYSPGIS 280

  Fly   267 FHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAPV-----YDQNF 326
            |..|:.|.:|.||||::|||.:.|.|||:..||:.|||:..|.:|..:.....|:     .|::.
plant   281 FSRLYPGANVLAIDLLQKMLVLDPSKRISVTEALQHPYMAPLYDPSANPPAQVPIDLDVDEDEDL 345

  Fly   327 ENMVLPVKCWKELVSH 342
            ...::....|||::.:
plant   346 GAEMIRELMWKEMIHY 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 130/341 (38%)
S_TKc 20..305 CDD:214567 120/288 (42%)
MPK2NP_564746.1 STKc_TEY_MAPK 26..363 CDD:143363 129/338 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm974
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.