DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MPK16

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_197402.1 Gene:MPK16 / 832019 AraportID:AT5G19010 Length:567 Species:Arabidopsis thaliana


Alignment Length:344 Identity:125/344 - (36%)
Similarity:193/344 - (56%) Gaps:15/344 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLN 84
            |.....:|.||:|.|.......|....|:|::...||...||....|||:||:.:.|.:::.:.:
plant    25 YRIEEVIGKGSYGVVCSAYDTHTGEKVAIKKINDIFEHVSDATRILREIKLLRLLRHPDIVEIKH 89

  Fly    85 VFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSK-RMSDQEIRIILYQILRGLKYIHSAGVVHRDL 148
            :..||:..  ||:.:|:|..||::|||:..::. .::.:..:..|||:||||||||:|.|.||||
plant    90 ILLPPSRR--EFRDIYVVFELMESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTANVFHRDL 152

  Fly   149 KPCNIAVNGNSEVRILDFGLSRMC------ADKMTDHVGTMWYLAPEII--FLRGQYTKAIDVWS 205
            ||.||..|.:.:::|.||||:|:.      |...||:|.|.||.|||:.  |. .:||.|||:||
plant   153 KPKNILANADCKLKICDFGLARVAFNDTPTAIFWTDYVATRWYRAPELCGSFF-SKYTPAIDIWS 216

  Fly   206 VGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCDFHHL 270
            :|||.|||:|.:.||.|:|.|.|:..:.:::|||:.|.|..:..|::|.||.....::...|.|.
plant   217 IGCIFAELLTGKPLFPGKNVVHQLDLMTDMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHK 281

  Fly   271 FMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDL--IEPHHHAEDTAPVYDQNFENMVLPV 333
            |...|..|:.|:||||...|:.|.||.||:...|.:.|  :|....|:....: :..||...:..
plant   282 FPHTDPLALRLLEKMLSFEPKDRPTAEEALADVYFKGLAKVEREPSAQPVTKL-EFEFERRRITK 345

  Fly   334 KCWKELVSHEIRNFRPDQL 352
            :..:||:..|...:.|..|
plant   346 EDVRELIYRESLEYHPKML 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 123/339 (36%)
S_TKc 20..305 CDD:214567 114/293 (39%)
MPK16NP_197402.1 STKc_TDY_MAPK 24..361 CDD:143364 123/339 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.