DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and AT4G01595

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_680555.2 Gene:AT4G01595 / 828086 AraportID:AT4G01595 Length:140 Species:Arabidopsis thaliana


Alignment Length:92 Identity:34/92 - (36%)
Similarity:57/92 - (61%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 GQYTKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGY 259
            |.||.||||||:|||.||::|.:.||.|::.|.|:..:.:::|||..:.|:|:..:::|.||...
plant    18 GLYTPAIDVWSIGCIFAEVLTWKPLFPGKSVVHQLELITDLLGTPKSDAISGVRNDKARKYLTEM 82

  Fly   260 PLRQRCDFHHLFMGYDVQAIDLMEKML 286
            ..:....|...|...|..|:.|::::|
plant    83 RKKNHVTFSQKFSKADPLALRLLQRLL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 34/92 (37%)
S_TKc 20..305 CDD:214567 34/92 (37%)
AT4G01595NP_680555.2 PKc_like <20..118 CDD:304357 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.