DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MPK5

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_567378.4 Gene:MPK5 / 826735 AraportID:AT4G11330 Length:376 Species:Arabidopsis thaliana


Alignment Length:334 Identity:136/334 - (40%)
Similarity:199/334 - (59%) Gaps:14/334 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLNVFH 87
            :|.:|.|::|.|.......|....|:|::.:.|:.:.|||.|.|||:||:|:.|.||:.:.::..
plant    46 IRPIGRGAYGFVCAAVDSETHEEIAIKKIGKAFDNKVDAKRTLREIKLLRHLEHENVVVIKDIIR 110

  Fly    88 PPAHNMMEFQQVYLVTHLMDADLHRYSRSKR-MSDQEIRIILYQILRGLKYIHSAGVVHRDLKPC 151
            ||...  :|..||:|..|||.|||:..||.: ::|...:..||||||||||||||.|:||||||.
plant   111 PPKKE--DFVDVYIVFELMDTDLHQIIRSNQSLNDDHCQYFLYQILRGLKYIHSANVLHRDLKPS 173

  Fly   152 NIAVNGNSEVRILDFGLSRMCADK--MTDHVGTMWYLAPEIIFLRGQYTKAIDVWSVGCILAELI 214
            |:.:|.|.:::|.||||:|..::.  ||::|.|.||.|||::....:||.||||||||||.||::
plant   174 NLLLNSNCDLKITDFGLARTTSETEYMTEYVVTRWYRAPELLLNSSEYTSAIDVWSVGCIFAEIM 238

  Fly   215 TDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCDFHHLFMGYDVQAI 279
            |...||.|::||.|::.:..::|:|....:..:....:|.|::..|...|.:|...|...:..||
plant   239 TREPLFPGKDYVHQLKLITELIGSPDGASLEFLRSANARKYVKELPKFPRQNFSARFPSMNSTAI 303

  Fly   280 DLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAPV----YDQNFENMVLPVKCWKELV 340
            ||:||||...|.||||..||:.:|||..|     |..:..||    :..:||:.....:..||||
plant   304 DLLEKMLVFDPVKRITVEEALCYPYLSAL-----HDLNDEPVCSNHFSFHFEDPSSTEEEIKELV 363

  Fly   341 SHEIRNFRP 349
            ..|...|.|
plant   364 WLESVKFNP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 135/332 (41%)
S_TKc 20..305 CDD:214567 121/284 (43%)
MPK5NP_567378.4 PKc_like 36..372 CDD:304357 135/332 (41%)
S_TKc 46..329 CDD:214567 121/284 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm974
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.