DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MPK10

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_191538.1 Gene:MPK10 / 825148 AraportID:AT3G59790 Length:393 Species:Arabidopsis thaliana


Alignment Length:355 Identity:133/355 - (37%)
Similarity:201/355 - (56%) Gaps:34/355 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LWEFPDIYE-FVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNH 76
            ::|.|..|: .:|.:|.|:.|.|.......|....|:|::.:.|:...:||.|.|||:||:|.:|
plant    52 IFELPAKYKPPIRPIGRGACGIVCSAVDSETNEKVAIKKITQVFDNTIEAKRTLREIKLLRHFDH 116

  Fly    77 RNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSKRMSDQEI-----RIILYQILRGLK 136
            .|::::.:|..||..:  .|:.||:|..||:.||:|..:    ||||:     ...:||||||||
plant   117 ENIVAIRDVILPPQRD--SFEDVYIVNELMEFDLYRTLK----SDQELTKDHGMYFMYQILRGLK 175

  Fly   137 YIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADK--MTDHVGTMWYLAPEIIFLRGQYTK 199
            |||||.|:||||||.|:.::...:::|.||||:|...:.  ||::|.|.||.|||::.....||.
plant   176 YIHSANVLHRDLKPSNLLLSTQCDLKICDFGLARATPESNLMTEYVVTRWYRAPELLLGSSDYTA 240

  Fly   200 AIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQR 264
            ||||||||||..|::....||.|::.|:|:|.|:.::|||:.|.:..:| |.::.|:...|...|
plant   241 AIDVWSVGCIFMEIMNREPLFPGKDQVNQLRLLLELIGTPSEEELGSLS-EYAKRYIRQLPTLPR 304

  Fly   265 CDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLR---------DLIEPHHHAEDTAP 320
            ..|...|......||||:||||...|::||:..||:.||||.         :..||.:...|..|
plant   305 QSFTEKFPNVPPLAIDLVEKMLTFDPKQRISVKEALAHPYLSSFHDITDEPECSEPFNFDLDEHP 369

  Fly   321 VYDQNFENMVLPVKCWKELVSHEIRNFRPD 350
            ..::.|          :||:..|...|.|:
plant   370 FSEEQF----------RELIYCEALAFNPE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 132/352 (38%)
S_TKc 20..305 CDD:214567 119/292 (41%)
MPK10NP_191538.1 PKc_like 53..388 CDD:304357 132/351 (38%)
S_TKc 63..345 CDD:214567 118/288 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm974
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.