DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MPK9

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001327296.1 Gene:MPK9 / 821329 AraportID:AT3G18040 Length:648 Species:Arabidopsis thaliana


Alignment Length:346 Identity:124/346 - (35%)
Similarity:192/346 - (55%) Gaps:19/346 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLN 84
            |:....:|.||:|.||......:....|:|::...||...||....|||:||:.:.|.:::.:.:
plant   132 YQIQEVIGKGSYGVVASAIDTHSGEKVAIKKINDVFEHVSDATRILREIKLLRLLRHPDIVEIKH 196

  Fly    85 VFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSK-RMSDQEIRIILYQILRGLKYIHSAGVVHRDL 148
            |..||:..  ||:.:|:|..||::|||:..::. .::.:..:..|||:|||||:||:|.|.||||
plant   197 VMLPPSRR--EFRDIYVVFELMESDLHQVIKANDDLTPEHYQFFLYQLLRGLKFIHTANVFHRDL 259

  Fly   149 KPCNIAVNGNSEVRILDFGLSRM------CADKMTDHVGTMWYLAPEII--FLRGQYTKAIDVWS 205
            ||.||..|.:.:::|.||||:|:      .|...||:|.|.||.|||:.  |. .:||.|||:||
plant   260 KPKNILANSDCKLKICDFGLARVSFNDAPSAIFWTDYVATRWYRAPELCGSFF-SKYTPAIDIWS 323

  Fly   206 VGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCDFHHL 270
            :|||.||::|.:.||.|:|.|.|:..:.:::|||..|.|..|..|::|.||.....:....|.|.
plant   324 IGCIFAEMLTGKPLFPGKNVVHQLDIMTDLLGTPPPEAIARIRNEKARRYLGNMRRKPPVPFTHK 388

  Fly   271 FMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLI----EPHHHAEDTAPVYDQNFENMVL 331
            |...|..|:.|:.::|...|:.|.:|.||:..||...|.    ||   :....|..:..||...:
plant   389 FPHVDPLALRLLHRLLAFDPKDRPSAEEALADPYFYGLANVDREP---STQPIPKLEFEFERRKI 450

  Fly   332 PVKCWKELVSHEIRNFRPDQL 352
            ..:..:||:..||..:.|..|
plant   451 TKEDVRELIYREILEYHPQML 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 122/341 (36%)
S_TKc 20..305 CDD:214567 111/293 (38%)
MPK9NP_001327296.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.