DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MPK20

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_565989.1 Gene:MPK20 / 818888 AraportID:AT2G42880 Length:606 Species:Arabidopsis thaliana


Alignment Length:359 Identity:124/359 - (34%)
Similarity:196/359 - (54%) Gaps:26/359 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FPDIYEFVRF-----LGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMN 75
            |.|..:..||     :|.||:|.|.......|....|:|::...||...||....|||:||:.:.
plant    16 FSDYGDANRFKVQEVIGKGSYGVVCSAIDTLTGEKVAIKKIHDIFEHISDAARILREIKLLRLLR 80

  Fly    76 HRNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSK-RMSDQEIRIILYQILRGLKYIH 139
            |.:::.:.::..||:..  ||:.:|:|..||::|||:..::. .::.:..:..|||:||.|||||
plant    81 HPDIVEIKHIMLPPSRR--EFKDIYVVFELMESDLHQVIKANDDLTREHYQFFLYQLLRALKYIH 143

  Fly   140 SAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADK------MTDHVGTMWYLAPEII-FLRGQY 197
            :|.|.||||||.||..|.|.:::|.||||:|:..:.      .||:|.|.||.|||:. ....:|
plant   144 TANVYHRDLKPKNILANANCKLKICDFGLARVAFNDTPTTIFWTDYVATRWYRAPELCGSFYSKY 208

  Fly   198 TKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLR 262
            |.|||:||:|||.||::..:.||.|:|.|.|:..:.:::|||:.:.|:.:..|::|.||.....:
plant   209 TPAIDIWSIGCIFAEVLMGKPLFPGKNVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKK 273

  Fly   263 QRCDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLI----EPHHHAEDTAPV-- 321
            ....|...|...|..::.|:|::|...|:.|.||.||:..||.:.|.    ||     ...|:  
plant   274 PPIPFAQKFPNADPLSLKLLERLLAFDPKDRPTAEEALADPYFKGLAKVEREP-----SCQPITK 333

  Fly   322 YDQNFENMVLPVKCWKELVSHEIRNFRPDQLDLH 355
            .:..||...:..:..:||:|.||..:.|..|..|
plant   334 MEFEFERRKVTKEDIRELISREILEYHPQLLKDH 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 121/351 (34%)
S_TKc 20..305 CDD:214567 107/297 (36%)
MPK20NP_565989.1 STKc_TDY_MAPK 24..361 CDD:143364 119/343 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.