DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MPK7

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_179409.1 Gene:MPK7 / 816330 AraportID:AT2G18170 Length:368 Species:Arabidopsis thaliana


Alignment Length:347 Identity:129/347 - (37%)
Similarity:203/347 - (58%) Gaps:13/347 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ESLWEFPDIYEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMN 75
            ::|:|....|..::.:|.|::|.|.....|.|....|:|::...||...||..|.||::||:|:.
plant    23 QTLFEIDTKYVPIKPIGRGAYGVVCSSINRETNERVAIKKIHNVFENRVDALRTLRELKLLRHVR 87

  Fly    76 HRNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSKR-MSDQEIRIILYQILRGLKYIH 139
            |.|||:|.:|..|.  |...|:.||||..|||.|||:..:|.: :||...:..|:|:||||||:|
plant    88 HENVIALKDVMLPA--NRSSFKDVYLVYELMDTDLHQIIKSSQSLSDDHCKYFLFQLLRGLKYLH 150

  Fly   140 SAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADK---MTDHVGTMWYLAPEIIFLRGQYTKAI 201
            ||.::||||||.|:.||.|.:::|.||||:|.....   ||::|.|.||.|||::.....|..:|
plant   151 SANILHRDLKPGNLLVNANCDLKICDFGLARTSQGNEQFMTEYVVTRWYRAPELLLCCDNYGTSI 215

  Fly   202 DVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCD 266
            ||||||||.||::..:.:|.|...::|::.:||::|:.....|..|...::|.:::..|..:...
plant   216 DVWSVGCIFAEILGRKPIFPGTECLNQLKLIINVVGSQQESDIRFIDNPKARRFIKSLPYSRGTH 280

  Fly   267 FHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAPV---YDQNFEN 328
            ..:|:...:..||||:::||...|.|||:..:|:||||:..|.:|..:.....|:   .|:|.|.
plant   281 LSNLYPQANPLAIDLLQRMLVFDPTKRISVTDALLHPYMAGLFDPGSNPPAHVPISLDIDENMEE 345

  Fly   329 MVLPVKCWKELVSH----EIRN 346
            .|:....|.|::.:    ||.|
plant   346 PVIREMMWNEMLYYHPEAEISN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 129/347 (37%)
S_TKc 20..305 CDD:214567 114/288 (40%)
MPK7NP_179409.1 STKc_TEY_MAPK 26..361 CDD:143363 125/336 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm974
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.