DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MPK17

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001030939.1 Gene:MPK17 / 814673 AraportID:AT2G01450 Length:486 Species:Arabidopsis thaliana


Alignment Length:347 Identity:122/347 - (35%)
Similarity:189/347 - (54%) Gaps:21/347 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLN 84
            |:....:|.||:|.||......|....|:|::...||...||....|||:||:.:.|.:::.:.:
plant    16 YQIQEVVGKGSYGVVASAECPHTGGKVAIKKMTNVFEHVSDAIRILREIKLLRLLRHPDIVEIKH 80

  Fly    85 VFHPPAHNMMEFQQVYLVTHLMDADLHRYSR-SKRMSDQEIRIILYQILRGLKYIHSAGVVHRDL 148
            :..||...  ||:.:|:|..||::|||...: :..::.|..:..|||:|||||::|||.|.||||
plant    81 IMLPPCRK--EFKDIYVVFELMESDLHHVLKVNDDLTPQHHQFFLYQLLRGLKFMHSAHVFHRDL 143

  Fly   149 KPCNIAVNGNSEVRILDFGLSRM------CADKMTDHVGTMWYLAPEII-FLRGQYTKAIDVWSV 206
            ||.||..|.:.:::|.|.||:|:      .|...||:|.|.||.|||:. .....||.|||:|||
plant   144 KPKNILANADCKIKICDLGLARVSFTDSPSAVFWTDYVATRWYRAPELCGSFYSNYTPAIDMWSV 208

  Fly   207 GCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCDFHHLF 271
            |||.||::|.:.||.|:|.|.|:..:.:::|||:...::.|..|::|.||.....:....|.|.|
plant   209 GCIFAEMLTGKPLFPGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGNMRRKDPVPFTHKF 273

  Fly   272 MGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDL----IEPHHHAEDTAPV--YDQNFENMV 330
            ...|..|:.|:::::...|:.|.:|.||:..||.:.|    .||...     |:  .:..||...
plant   274 PNIDPVALKLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQ-----PISKLEFEFERRK 333

  Fly   331 LPVKCWKELVSHEIRNFRPDQL 352
            |.....:||:..||..:.|..|
plant   334 LTRDDVRELMYREILEYHPQML 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 120/342 (35%)
S_TKc 20..305 CDD:214567 108/292 (37%)
MPK17NP_001030939.1 STKc_TDY_MAPK 15..352 CDD:143364 120/342 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.