DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and Mapk6

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_113810.2 Gene:Mapk6 / 58840 RGDID:62087 Length:720 Species:Rattus norvegicus


Alignment Length:382 Identity:109/382 - (28%)
Similarity:175/382 - (45%) Gaps:68/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLN 84
            |..::.||.|..|.|........:...|:|:::  ....:..|...|||::::.::|.|::.:..
  Rat    20 YMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIV--LTDPQSVKHALREIKIIRRLDHDNIVKVFE 82

  Fly    85 VFHPPAH-------NMMEFQQVYLVTHLMDADLHRYSRSKRMSDQEIRIILYQILRGLKYIHSAG 142
            :..|...       ::.|...||:|...|:.||........:.::..|:.:||:||||||||||.
  Rat    83 ILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGLKYIHSAN 147

  Fly   143 VVHRDLKPCNIAVNGNSEV-RILDFGLSRMCADKMTDHVG-------TMWYLAPEIIFLRGQYTK 199
            |:||||||.|:.:|....| :|.||||:|: .|....|.|       |.||.:|.::.....|||
  Rat   148 VLHRDLKPANLFINTEDLVLKIGDFGLARI-MDPHYSHKGHLSEGLVTKWYRSPRLLLSPNNYTK 211

  Fly   200 AIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQR 264
            |||:|:.|||.||::|.:.||.|.:.:.|::.::        |.|..:..|..:..|...|:..|
  Rat   212 AIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLIL--------ESIPVVHEEDRQELLSVIPVYIR 268

  Fly   265 CDF---H----HLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLR---------------- 306
            .|.   |    .|..|...:|:|.:|::|...|..|:||.||:.|||:.                
  Rat   269 NDMTEPHKPLTQLLPGISREALDFLEQILTFSPMDRLTAEEALSHPYMSIYSFPTDEPISSHPFH 333

  Fly   307 ------DLI---EPHHHAEDTAPVYDQNFENMVLPVKCWKELVSHEIRNFRPDQLDL 354
                  |::   |.|.|..:....:|..|.....|:.          .||..|::.|
  Rat   334 IEDEVDDILLMDETHSHIYNWERYHDCQFSEHDWPIH----------NNFDIDEVQL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 107/375 (29%)
S_TKc 20..305 CDD:214567 97/306 (32%)
Mapk6NP_113810.2 STKc_MAPK4_6 14..355 CDD:143359 102/345 (30%)
S_TKc 20..316 CDD:214567 97/306 (32%)
SEG motif 189..191 0/1 (0%)
FRIEDE motif 332..337 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 638..657
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 698..720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.