DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MAPK8

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001265476.1 Gene:MAPK8 / 5599 HGNCID:6881 Length:427 Species:Homo sapiens


Alignment Length:360 Identity:135/360 - (37%)
Similarity:202/360 - (56%) Gaps:28/360 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVRVAINESLWEFPDIYEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREI 68
            |..|.|.:|.:.....|:.::.:|.|:.|.|........|...|:|:|.|||:.:..||..|||:
Human    10 FYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYREL 74

  Fly    69 RLLKHMNHRNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSKRMSDQEIRIILYQILR 133
            .|:|.:||:|:|.||||| .|..::.|||.||:|..||||:|.:..:.: :..:.:..:|||:|.
Human    75 VLMKCVNHKNIIGLLNVF-TPQKSLEEFQDVYIVMELMDANLCQVIQME-LDHERMSYLLYQMLC 137

  Fly   134 GLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADK--MTDHVGTMWYLAPEIIFLRGQ 196
            |:|::||||::||||||.||.|..:..::||||||:|.....  ||.:|.|.:|.|||:|...| 
Human   138 GIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMG- 201

  Fly   197 YTKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPL 261
            |.:.:|:||||||:.|:|...|||.|.:::.|...:|..:|||..||:..: ....|.|:|..|.
Human   202 YKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPK 265

  Fly   262 RQRCDFHHLFMGYDV--------------QAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPH 312
            .....|..||.  ||              ||.||:.|||.:...|||:..||:.|||:....:| 
Human   266 YAGYSFEKLFP--DVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDP- 327

  Fly   313 HHAEDTAP---VYDQNFENMVLPVKCWKELVSHEI 344
              :|..||   :.|:..:.....::.||||:..|:
Human   328 --SEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 135/360 (38%)
S_TKc 20..305 CDD:214567 120/300 (40%)
MAPK8NP_001265476.1 STKc_JNK 25..360 CDD:270840 130/343 (38%)
TXY 183..185 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.