DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and MAPK3

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_002737.2 Gene:MAPK3 / 5595 HGNCID:6877 Length:379 Species:Homo sapiens


Alignment Length:345 Identity:133/345 - (38%)
Similarity:208/345 - (60%) Gaps:20/345 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLN 84
            |..::::|.|::|.|:.......:...|:|:: .|||.:...:.|.|||::|....|.|||.:.:
Human    42 YTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKI-SPFEHQTYCQRTLREIQILLRFRHENVIGIRD 105

  Fly    85 VFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSKRMSDQEIRIILYQILRGLKYIHSAGVVHRDLK 149
            :..  |..:...:.||:|..||:.||::..:|:::|:..|...||||||||||||||.|:|||||
Human   106 ILR--ASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLK 168

  Fly   150 PCNIAVNGNSEVRILDFGLSRMCADKMTDHVG-------TMWYLAPEIIFLRGQYTKAIDVWSVG 207
            |.|:.:|...:::|.||||:|: ||...||.|       |.||.||||:.....|||:||:||||
Human   169 PSNLLINTTCDLKICDFGLARI-ADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVG 232

  Fly   208 CILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCDFHHLFM 272
            |||||::::|.:|.|::|:.|:..::.|:|:|::|.:..|...::||||:..|.:.:..:..||.
Human   233 CILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFP 297

  Fly   273 GYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAPVYDQNF----ENMVLPV 333
            ..|.:|:||:::||...|.||||..||:.||||....:|     ...||.::.|    |...||.
Human   298 KSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDP-----TDEPVAEEPFTFAMELDDLPK 357

  Fly   334 KCWKELVSHEIRNFRPDQLD 353
            :..|||:..|...|:|..|:
Human   358 ERLKELIFQETARFQPGVLE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 131/339 (39%)
S_TKc 20..305 CDD:214567 117/291 (40%)
MAPK3NP_002737.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
STKc_ERK1_2_like 36..370 CDD:270839 130/336 (39%)
TXY 202..204 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.