DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and Mapk4

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_062192.1 Gene:Mapk4 / 54268 RGDID:3047 Length:583 Species:Rattus norvegicus


Alignment Length:363 Identity:108/363 - (29%)
Similarity:181/363 - (49%) Gaps:58/363 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGGGSFGQVAKVRLRGTEN----YFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLNVF 86
            ||.|..|.|    |..|::    ..|:|:::....|  ..|...|||::::.::|.|::.:..|.
  Rat    26 LGFGVNGLV----LSATDSRACRKVAVKKIVLSDAR--SMKHALREIKIIRRLDHDNIVKVYEVL 84

  Fly    87 HPPAHN----MMEFQQVYLVTHLMDADLHRYSRSKRMSDQEIRIILYQILRGLKYIHSAGVVHRD 147
            .|...:    :.:|...|:|...|:.||........::::..::.:||:||||||||||.|:|||
  Rat    85 GPKGSDLQGELFKFSVAYIVQEYMETDLACLLEQGTLTEEHAKLFMYQLLRGLKYIHSANVLHRD 149

  Fly   148 LKPCNIAVNGNSEV-RILDFGLSRMCADKMTDHVG-------TMWYLAPEIIFLRGQYTKAIDVW 204
            |||.||.::....| :|.||||:|: ||:...|.|       |.||.:|.::.....||||||:|
  Rat   150 LKPANIFISTEDLVLKIGDFGLARI-ADQHYSHKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMW 213

  Fly   205 SVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTRE-----------FITGISMERSRNYLEG 258
            :.||||||::|.::||.|.:.:.|::.:::.:.....|           |::. :.|..|     
  Rat   214 AAGCILAEMLTGKMLFAGAHELEQMQLILDTIPVVREEDKEELLRVMPSFVSS-TWEVKR----- 272

  Fly   259 YPLRQRCDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAPV-Y 322
             |||:      |....:.:|||.:||:|...|..|:||...:.|||:.....|........|. .
  Rat   273 -PLRK------LLPDVNREAIDFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRI 330

  Fly   323 DQNFENMVLPVKCWKEL---------VSHEIRNFRPDQ 351
            :...:::||......:|         :|.:: .:|||:
  Rat   331 EDEIDDLVLMAASQSQLSNWDRYPVSLSSDL-EWRPDR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 105/359 (29%)
S_TKc 20..305 CDD:214567 98/305 (32%)
Mapk4NP_062192.1 STKc_MAPK4_6 14..351 CDD:143359 104/344 (30%)
Pkinase 20..312 CDD:278497 98/305 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.