DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and Srpk79D

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001246881.1 Gene:Srpk79D / 40461 FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster


Alignment Length:174 Identity:46/174 - (26%)
Similarity:73/174 - (41%) Gaps:32/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 NGNSEVRILDFGLSRMCAD--KMTDHVGTMWYLAPEIIFLRGQYTKAIDVWSVGCILAELITDRV 218
            |.|..|:|.|.|  ..|.|  ..|:.:.|..|.:.|:: |...|....|:||..|:..||.|...
  Fly   847 NSNVRVKIADLG--NACYDYHHFTEDIQTRQYRSIEVL-LGAPYNYTADIWSTACLAFELATGDY 908

  Fly   219 LF---RGENY---VSQIRCLINIMGTPTR----------EFITGISMERSRNYLEGYPLRQRCDF 267
            ||   .||:|   ...:..::.::|:..:          ::.|.....|:...|:.:.|     .
  Fly   909 LFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSL-----M 968

  Fly   268 HHLFMGYDVQAI------DLMEKMLEMVPEKRITAAEAMLHPYL 305
            :.|...||...:      |.:..|||..|..|.:|||.:.||:|
  Fly   969 NVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 46/174 (26%)
S_TKc 20..305 CDD:214567 45/172 (26%)
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038
S_TKc 347..>492 CDD:214567
STKc_SRPK <844..1012 CDD:271038 45/172 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.