DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and nmo

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster


Alignment Length:372 Identity:127/372 - (34%)
Similarity:197/372 - (52%) Gaps:57/372 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PDIYEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVIS 81
            ||     |.:|.|:||.|..|.........|:|:|...|:....:|..:||:::|....|.||:|
  Fly    42 PD-----RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLS 101

  Fly    82 LLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRS-KRMSDQEIRIILYQILRGLKYIHSAGVVH 145
            .|::..||  ::..||::|::|.|:.:|||:...| :.:|...|::.||||||||||:|||.::|
  Fly   102 ALDILQPP--HLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILH 164

  Fly   146 RDLKPCNIAVNGNSEVRILDFGLSRM----CADKMTDHVGTMWYLAPEIIFLRGQYTKAIDVWSV 206
            ||:||.|:.||.|..::|.||||:|:    .|..||..|.|.:|.||||:.....|:.|:|||||
  Fly   165 RDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSV 229

  Fly   207 GCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEG---YPLRQRCDFH 268
            |||..||:..|:||:.:|.|.|:..:..::||||        ||..|:..||   :.||:.....
  Fly   230 GCIFGELLGRRILFQAQNPVQQLELITELLGTPT--------MEDMRHACEGARTHMLRRAPKPP 286

  Fly   269 HLFMGYDV------QAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHH-------------- 313
            ...:.|.:      :|:.|:.:||...|:|||:..:|:.||||.:....:|              
  Fly   287 SFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGM 351

  Fly   314 --HAEDTAPVYDQNFENMVLPVKCWK------ELVSHEIRNFRPDQL 352
              :..|..|...|.|:::      |:      :.|..|:..|..:||
  Fly   352 RQYTADFEPSAGQPFDDL------WERKLTSVQQVKEEMHKFIAEQL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 125/367 (34%)
S_TKc 20..305 CDD:214567 112/298 (38%)
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 127/372 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34458at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.