DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and SRPK

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001369087.1 Gene:SRPK / 36706 FlyBaseID:FBgn0286813 Length:1009 Species:Drosophila melanogaster


Alignment Length:201 Identity:58/201 - (28%)
Similarity:82/201 - (40%) Gaps:45/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LKPCNIAVNGNSEVRILDFGLSRMCADKMTDHVGTMWYLAPEIIFLRGQYTKAIDVWSVGCILAE 212
            |..||:      .|:|.|.|.:.......|:.:.|..|.:.|:|...| |..:.|:||..|::.|
  Fly   596 LDECNV------HVKIADLGNACWVDRHFTEDIQTRQYRSLEVIIGAG-YNTSADIWSTACMVFE 653

  Fly   213 LITDRVLFR---GENYV---SQIRCLINIMGTPTREFI-----TGISMERS---RN--------- 254
            |.|...||.   ||:|.   ..:..:|.::|...||.:     ...|..||   ||         
  Fly   654 LATGDYLFEPHSGESYTRDEDHLAHIIELLGPIPREILLNGTYAAKSFTRSCELRNISGLKPWGL 718

  Fly   255 ---YLEGYPLRQRCDFHHLFMGYDVQAI-DLMEKMLEMVPEKRITAAEAMLHPYLR-DLIEPHHH 314
               .||.|...|:          |..:. ..:..|||..|.||.||||.:.||:|| |.::|...
  Fly   719 MDVLLEKYEWSQK----------DAASFASFLTPMLEFDPNKRATAAECLQHPWLRXDTMQPGCW 773

  Fly   315 AEDTAP 320
            ...|.|
  Fly   774 LRATQP 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 58/201 (29%)
S_TKc 20..305 CDD:214567 52/183 (28%)
SRPKNP_001369087.1 PKc_like 159..>318 CDD:419665
PKc_like <600..763 CDD:419665 50/179 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.