Sequence 1: | NP_996277.1 | Gene: | p38c / 2768679 | FlyBaseID: | FBgn0267339 | Length: | 356 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001369087.1 | Gene: | SRPK / 36706 | FlyBaseID: | FBgn0286813 | Length: | 1009 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 58/201 - (28%) |
---|---|---|---|
Similarity: | 82/201 - (40%) | Gaps: | 45/201 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 LKPCNIAVNGNSEVRILDFGLSRMCADKMTDHVGTMWYLAPEIIFLRGQYTKAIDVWSVGCILAE 212
Fly 213 LITDRVLFR---GENYV---SQIRCLINIMGTPTREFI-----TGISMERS---RN--------- 254
Fly 255 ---YLEGYPLRQRCDFHHLFMGYDVQAI-DLMEKMLEMVPEKRITAAEAMLHPYLR-DLIEPHHH 314
Fly 315 AEDTAP 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
p38c | NP_996277.1 | STKc_p38 | 4..349 | CDD:143356 | 58/201 (29%) |
S_TKc | 20..305 | CDD:214567 | 52/183 (28%) | ||
SRPK | NP_001369087.1 | PKc_like | 159..>318 | CDD:419665 | |
PKc_like | <600..763 | CDD:419665 | 50/179 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24055 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |