DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and rl

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:360 Identity:134/360 - (37%)
Similarity:205/360 - (56%) Gaps:12/360 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEFVRVAINESLWEFPDIYEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTY 65
            :|:.....|...::|....|..:.::|.|::|.|.......|....|:|:: .|||.:...:.|.
  Fly    19 VPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTL 82

  Fly    66 REIRLLKHMNHRNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSKRMSDQEIRIILYQ 130
            |||.:|....|.|:|.:.::....:.:.|  :.||:|..||:.||::..:::|:|:..|...|||
  Fly    83 REITILTRFKHENIIDIRDILRVDSIDQM--RDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQ 145

  Fly   131 ILRGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADKMTDHVG-------TMWYLAP 188
            |||||||||||.|:||||||.|:.:|...:::|.||||:|: ||...||.|       |.||.||
  Fly   146 ILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARI-ADPEHDHTGFLTEYVATRWYRAP 209

  Fly   189 EIIFLRGQYTKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSR 253
            ||:.....|||:||:|||||||||::::|.:|.|::|:.|:..::.::|:|:|:.:..|..|::|
  Fly   210 EIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKAR 274

  Fly   254 NYLEGYPLRQRCDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDT 318
            ||||..|.:....:..||...|..|:||:.|||...|.|||...||:.||||....:|.......
  Fly   275 NYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAE 339

  Fly   319 APVYDQNFENMVLPVKCWKELVSHEIRNFRPDQLD 353
            .| :..|.||..:.....|.|:..|...|:..|.|
  Fly   340 VP-FRINMENDDISRDALKSLIFEETLKFKERQPD 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 131/351 (37%)
S_TKc 20..305 CDD:214567 118/291 (41%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 129/338 (38%)
S_TKc 38..326 CDD:214567 118/291 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442169
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34458at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2432
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.