DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and CG8565

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_573080.1 Gene:CG8565 / 32538 FlyBaseID:FBgn0030697 Length:790 Species:Drosophila melanogaster


Alignment Length:199 Identity:51/199 - (25%)
Similarity:82/199 - (41%) Gaps:50/199 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 DLKPCNIAVNG-NSEVRILDFGLSRMCADKMTDHVGTMWYLAPEIIFLRGQYTKAIDVWSVGCIL 210
            |:.|.:.|.|. :..|:|.|.|.:.......||.:.|..|.|.|:|...| |.:..|:|||.|:|
  Fly   546 DIYPIDPANNECDVRVKIADLGNACYFHHHFTDDIQTKEYRALEVILGAG-YCETADIWSVACLL 609

  Fly   211 AELITDRVLF-----RGENYVSQIRCLINIMGT----PTREFITGISMERSRNYLE--------- 257
            .||.|...||     ||:..:.::. :..|:.|    |......|   :.|||::.         
  Fly   610 WELATGTYLFDTHSKRGKYNLDEVH-IAKIVETCGRIPWYLIRKG---KHSRNFINSAGKLCNIE 670

  Fly   258 ---------------GYPLRQRCDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRD 307
                           |:..||..:|           ::.:..||:..|..||:|::|:...||.:
  Fly   671 TLKPLKLANILIRWYGWRTRQSTEF-----------VNFLMPMLQTNPLSRISASKALESHYLCN 724

  Fly   308 LIEP 311
            :..|
  Fly   725 IALP 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 51/199 (26%)
S_TKc 20..305 CDD:214567 48/191 (25%)
CG8565NP_573080.1 PKc_like 192..722 CDD:304357 48/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.