DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38c and srpk1a

DIOPT Version :9

Sequence 1:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_955944.1 Gene:srpk1a / 323679 ZFINID:ZDB-GENE-030131-2399 Length:634 Species:Danio rerio


Alignment Length:297 Identity:77/297 - (25%)
Similarity:118/297 - (39%) Gaps:75/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EEDAKGTYREIRLLKHMNHRNVISLLNVFHPP---AHNMMEF----------QQVYL-----VTH 104
            |||.:|..:..:||:..:|       |....|   |.:|.|:          |..|.     ...
Zfish   362 EEDEQGDLQYGQLLQEDHH-------NANAGPEDTAQSMYEYCNGAESPELDQACYSNGTSGQEQ 419

  Fly   105 LMDADL-----HRYSRSKRMSDQEIRIILYQILRGLKYIHSAG-VVHRDLKPCNIAVNGNSEVRI 163
            |.|.:|     |:.....|..:|....|....|       ||| ::...|.|.|.   ...:|:|
Zfish   420 LEDGELATEEQHQQKTRTRAREQNKDKIKDDKL-------SAGSLLVNPLDPLNA---DKIKVKI 474

  Fly   164 LDFGLSRMCADKMTDHVGTMWYLAPEIIFLRGQYTKAIDVWSVGCILAELITDRVLFR---GENY 225
            .|.|.:.......|:.:.|..|.:.|::...|..|.| |:||..|:..||.|...||.   ||:|
Zfish   475 ADLGNACWVHKHFTEDIQTRQYRSLEVLLGSGYNTPA-DIWSTACMAFELATGDYLFEPHSGEDY 538

  Fly   226 ---VSQIRCLINIMG-TPTREFITGISMERSRNYLEGYPLRQRCDFHHLFMGYDVQAID-LMEK- 284
               ...|..:|.::| .|.:..:||   :.|:.:..     ::.|..|:........:| ||:| 
Zfish   539 SRDEDHIALIIELLGVVPRKLVLTG---KYSKEFFS-----KKGDLKHITKLKPWGLLDVLMDKY 595

  Fly   285 ----------------MLEMVPEKRITAAEAMLHPYL 305
                            |||::||||.|||:.:.||:|
Zfish   596 EWPQEEAQTFSDFLLPMLELLPEKRATAADCLRHPWL 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 77/297 (26%)
S_TKc 20..305 CDD:214567 76/295 (26%)
srpk1aNP_955944.1 PKc_like 72..632 CDD:304357 76/295 (26%)
S_TKc 82..>224 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.